| Clone Name | rbaal39h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLND_NITOC (Q3JCX7) [Protein-PII] uridylyltransferase (EC 2.7.7.... | 33 | 0.45 | 2 | PPH_MYCPN (P75525) Putative protein phosphatase (EC 3.1.3.16) | 33 | 0.59 | 3 | FIXF_RHISN (P55467) Protein fixF | 29 | 6.5 |
|---|
>GLND_NITOC (Q3JCX7) [Protein-PII] uridylyltransferase (EC 2.7.7.59) (PII| uridylyl-transferase) (Uridylyl-removing enzyme) (UTase) Length = 892 Score = 33.1 bits (74), Expect = 0.45 Identities = 17/31 (54%), Positives = 21/31 (67%) Frame = -3 Query: 368 FNRGSFDSFLQLDFLGVDKRKGVGGSSAFLY 276 FN SFDS LQ DFL V +RK + S +FL+ Sbjct: 238 FNTWSFDSLLQHDFLTVSERKELLESQSFLW 268
>PPH_MYCPN (P75525) Putative protein phosphatase (EC 3.1.3.16)| Length = 259 Score = 32.7 bits (73), Expect = 0.59 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = +1 Query: 115 VFVFNSMVSKSYKEWIEDTFIYTNRTQVVCLHMIKRGTRKYAYIAL*LLL 264 VF F+S ++ K+W E T I RT IKR ++A +A L+L Sbjct: 67 VFDFHSQTERAVKQWFEITLIEARRTLEQYFQTIKRNQVQFARMATTLVL 116
>FIXF_RHISN (P55467) Protein fixF| Length = 402 Score = 29.3 bits (64), Expect = 6.5 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -3 Query: 401 PEHILAVVTSGFNR-----GSFDSFLQLDFLGVDKRKGVGGSSAF 282 PE +LA + GF R G F LQ+D +G++ V SAF Sbjct: 138 PESVLAEASKGFKRVFVEDGFFPGTLQIDPVGINAANSVPRCSAF 182 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,401,509 Number of Sequences: 219361 Number of extensions: 1562345 Number of successful extensions: 3764 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3763 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)