| Clone Name | rbaal38p16 |
|---|---|
| Clone Library Name | barley_pub |
>ILR1_ARATH (P54968) IAA-amino acid hydrolase ILR1 precursor (EC 3.5.1.-)| Length = 442 Score = 28.9 bits (63), Expect = 3.6 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +2 Query: 68 NKISMRCHGCSFDRRARPLVTVQELLPLNKHLLLRQGKTESQPG 199 +K+ + H C D L+ +LL KHL+ K QPG Sbjct: 129 SKVDGKMHACGHDTHVAMLLGAAKLLQTTKHLIKGTVKLVFQPG 172
>KPB2_MOUSE (Q8BWJ3) Phosphorylase b kinase alpha regulatory chain, liver isoform| (Phosphorylase kinase alpha L subunit) Length = 1235 Score = 28.5 bits (62), Expect = 4.7 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 Query: 35 NRSTDSPFAKHNKISMRCHGCSFDRRARPLVTVQELLP 148 NR + K KI +CHG S D P T QE+ P Sbjct: 1078 NRVPVGFYQKVWKILQKCHGLSIDGYVLPSSTTQEMTP 1115
>ITA8_CHICK (P26009) Integrin alpha-8 precursor [Contains: Integrin alpha-8| heavy chain; Integrin alpha-8 light chain] Length = 1044 Score = 28.5 bits (62), Expect = 4.7 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 110 RARPLVTVQELLPLNKHLLLRQGKTESQPG 199 RARP+VTV LL LN ++ KT PG Sbjct: 464 RARPVVTVNALLILNPMIVNPDNKTCQPPG 493
>LSPA_CHLTR (O84413) Lipoprotein signal peptidase (EC 3.4.23.36)| (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) Length = 167 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 107 CQMSIHGSAWKFCYVWQKESLLI 39 CQ+S H SA+ + YVW S LI Sbjct: 31 CQLSPHSSAFLYSYVWGHFSFLI 53
>GSHB_RALSO (P58579) Glutathione synthetase (EC 6.3.2.3) (Glutathione synthase)| (GSH synthetase) (GSH-S) (GSHase) Length = 324 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 186 SVFPCRNSRCLFRGNNSCTVTKGLARLSNEHPWQR 82 +++ C+ S+ GN TV LA +EH W R Sbjct: 33 AIYTCQQSQLTLSGNVVETVATPLALTGDEHDWYR 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,787,826 Number of Sequences: 219361 Number of extensions: 523731 Number of successful extensions: 1403 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1403 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)