| Clone Name | rbaal39e18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EXEC1_ARATH (Q93YW0) EXECUTER1 protein, chloroplast precursor | 91 | 2e-18 | 2 | SSG2_AVESA (P14812) 12S seed storage globulin 2 precursor [Conta... | 32 | 2.1 | 3 | SSG1_AVESA (P12615) 12S seed storage globulin 1 precursor [Conta... | 32 | 2.1 | 4 | SUWA_DROME (P12297) Protein suppressor of white apricot | 30 | 6.1 |
|---|
>EXEC1_ARATH (Q93YW0) EXECUTER1 protein, chloroplast precursor| Length = 684 Score = 91.3 bits (225), Expect = 2e-18 Identities = 43/75 (57%), Positives = 55/75 (73%) Frame = -1 Query: 645 LENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGELLVLNGKSAIPHIGGAELGFLYS 466 L ++G PEEFGV A YKGQGR+A PGF+NPRWVDGEL++L+GK GG +GF+Y Sbjct: 611 LPHKGLIPEEFGVIARYKGQGRLADPGFRNPRWVDGELVILDGKYV---KGGPVVGFVYW 667 Query: 465 VPEQSFLVLFDRLTL 421 PE F++ F+RL L Sbjct: 668 APEYHFVMFFNRLRL 682
>SSG2_AVESA (P14812) 12S seed storage globulin 2 precursor [Contains: 12S seed| storage globulin 2 acidic chain; 12S seed storage globulin 2 basic chain] Length = 518 Score = 31.6 bits (70), Expect = 2.1 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 25 FCSIKAIPKLVSSKRANERNPRKGRARHVYNR 120 FCS++A + + KRA+ NPR GR H+ ++ Sbjct: 323 FCSLEARQNIENPKRADTYNPRAGRITHLNSK 354
>SSG1_AVESA (P12615) 12S seed storage globulin 1 precursor [Contains: 12S seed| storage globulin 1 acidic chain; 12S seed storage globulin 1 basic chain] Length = 518 Score = 31.6 bits (70), Expect = 2.1 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 25 FCSIKAIPKLVSSKRANERNPRKGRARHVYNR 120 FCS++A + + KRA+ NPR GR H+ ++ Sbjct: 323 FCSLEARQNIENPKRADTYNPRAGRITHLNSK 354
>SUWA_DROME (P12297) Protein suppressor of white apricot| Length = 963 Score = 30.0 bits (66), Expect = 6.1 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = +2 Query: 374 THERTSSYQRDLAHSGSV---RRSKRTRKLCSGTLYRKPSSAPP 496 TH R+ S +++ S S R S R R+ S L R+PSS PP Sbjct: 837 THRRSRSRSKNVRSSDSSPSSRESSRRRRQKSSRLSREPSSNPP 880 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,977,215 Number of Sequences: 219361 Number of extensions: 1836753 Number of successful extensions: 5032 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5029 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)