| Clone Name | rbaal39e13 |
|---|---|
| Clone Library Name | barley_pub |
>GP157_HUMAN (Q5UAW9) Probable G-protein coupled receptor 157| Length = 335 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 32 LRLPSMAIDPGCGHSLLRAISLINIASCTRCGVRRFFIRLICCCSS 169 ++ P + + G G++ + I CTR R F CCCSS Sbjct: 255 VQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSS 300
>KRA47_HUMAN (Q9BYR0) Keratin-associated protein 4-7 (Keratin-associated protein| 4.7) (Ultrahigh sulfur keratin-associated protein 4.7) Length = 210 Score = 29.3 bits (64), Expect = 2.8 Identities = 19/58 (32%), Positives = 25/58 (43%) Frame = +2 Query: 44 SMAIDPGCGHSLLRAISLINIASCTRCGVRRFFIRLICCCSS*YLPRCGESMRFTPSC 217 S+ D GCG L + T C R R CC SS P+C +S+ P+C Sbjct: 8 SVCSDQGCGQVLCQETCCRPSCCQTTC-CRTTCYRPSCCVSSCCRPQCCQSVCCQPTC 64
>KR414_HUMAN (Q9BYQ6) Keratin-associated protein 4-14 (Keratin-associated| protein 4.14) (Ultrahigh sulfur keratin-associated protein 4.14) Length = 195 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +2 Query: 44 SMAIDPGCGHSLLRAISLINIASCTRCGVRRFFIRLICCCSS*YLPRCGESMRFTPSC 217 S+ GCG L + + + C R + R CC SS P+C +S+ P+C Sbjct: 8 SVCSHQGCGQDLCQE-TCCRPSCCETTCCRTTYCRPSCCVSSCCRPQCCQSVCCQPTC 64
>MRE11_PYRHO (O58686) DNA double-strand break repair protein mre11| Length = 413 Score = 29.3 bits (64), Expect = 2.8 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 19 EREVPPFAIDGNRSRLWSQPSSCHQLNQHRLLHPV 123 E +P FAI+GN R PS H L LL+ + Sbjct: 73 ENNIPVFAIEGNHDRTQRGPSVLHLLEDLGLLYVI 107
>EDG4_HUMAN (Q9HBW0) Lysophosphatidic acid receptor Edg-4 (LPA receptor 2)| (LPA-2) Length = 351 Score = 28.5 bits (62), Expect = 4.8 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +2 Query: 77 LLRAISLINIA--SCTRCGVRRFFIRLICCCSS*YLPRCGESMRFTPS 214 L A SL+N A SC +RR F RL+CC R ES+ +T S Sbjct: 283 LAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTR--ESVHYTSS 328
>SPAG8_HUMAN (Q99932) Sperm-associated antigen 8 (Sperm membrane protein 1)| (SMP-1) (HSD-1) (Sperm membrane protein BS-84) Length = 426 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 113 RRRC*LS*WHEEGCDHNLDLLPSMANGGTS 24 R +C L W EE ++LD +PSM +G S Sbjct: 277 RGQCLLYNWEEERATNHLDQVPSMQDGSES 306
>KRA42_HUMAN (Q9BYR5) Keratin-associated protein 4-2 (Keratin-associated protein| 4.2) (Ultrahigh sulfur keratin-associated protein 4.2) Length = 136 Score = 28.1 bits (61), Expect = 6.3 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 4/70 (5%) Frame = +2 Query: 20 RGRCLRLPSMAID----PGCGHSLLRAISLINIASCTRCGVRRFFIRLICCCSS*YLPRC 187 R C R PS + P C S+ + + + C R R CC SS + P+C Sbjct: 32 RTTCCR-PSCCVSSCCRPQCCQSVCCQPTCCSPSCCQTTCCRTTCCRPSCCVSSCFRPQC 90 Query: 188 GESMRFTPSC 217 +S+ P+C Sbjct: 91 CQSVCCQPTC 100
>EDG4_MACFA (Q95KH4) Lysophosphatidic acid receptor Edg-4 (LPA receptor 2)| (LPA-2) Length = 351 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +2 Query: 77 LLRAISLINIA--SCTRCGVRRFFIRLICC 160 L A SL+N A SC +RR F RL+CC Sbjct: 283 LAEANSLVNAAVYSCRDAEMRRTFRRLLCC 312
>MRE11_PYRAB (Q9UZC9) DNA double-strand break repair protein mre11| Length = 423 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 19 EREVPPFAIDGNRSRLWSQPSSCHQLNQHRLLH 117 + +P FAI+GN R PS H L LL+ Sbjct: 83 DNNIPVFAIEGNHDRTQRGPSILHLLEDLGLLY 115
>SP8_MOUSE (Q8BMJ8) Transcription factor Sp8| Length = 486 Score = 27.7 bits (60), Expect = 8.2 Identities = 19/60 (31%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Frame = +2 Query: 41 PSMAIDP--GCGHSLLRAISLINIASCTRCGVRRFFIRLICCCSS*YLPRCGESMRFTPS 214 P A P G G S+L A + R RR+ R C C P C E+ R P+ Sbjct: 292 PDSAPSPLAGAGSSMLSAGPAAQLGGSPRSSARRYSGRATCDC-----PNCQEAERLGPA 346 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,396,424 Number of Sequences: 219361 Number of extensions: 503376 Number of successful extensions: 1250 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1246 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)