| Clone Name | rbaal38p01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ADA1D_PIG (Q9TTM9) Alpha-1D adrenergic receptor (Alpha 1D-adreno... | 29 | 2.9 | 2 | BPIL1_MOUSE (Q8C1E1) Bactericidal/permeability-increasing protei... | 28 | 4.9 | 3 | OPRL_LYCES (Q9FEX0) 12-oxophytodienoate reductase-like protein (... | 28 | 4.9 | 4 | EFP_RHOBA (Q7UXN7) Elongation factor P (EF-P) | 28 | 8.3 |
|---|
>ADA1D_PIG (Q9TTM9) Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor)| (Alpha 1D-adrenoreceptor) Length = 571 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = -3 Query: 190 GSSTCRAPICAAYQRVSVISPNIPRDIVVFLVWFGVELSSLAN 62 GS+ C CA V +S N+P D W EL+ ++ Sbjct: 523 GSAPCAEAPCALRSEVEAVSLNVPHDAAEGATWQAYELADYSH 565
>BPIL1_MOUSE (Q8C1E1) Bactericidal/permeability-increasing protein-like 1| precursor Length = 462 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 148 RVSVISPNIPRDIVVFLVWFGVELSSLANF 59 RV ++ ++P + F+ FGV LS+ ANF Sbjct: 71 RVQILDAHVPFFYLKFIAGFGVHLSAAANF 100
>OPRL_LYCES (Q9FEX0) 12-oxophytodienoate reductase-like protein (EC 1.3.1.-)| (LeOPR2) Length = 355 Score = 28.5 bits (62), Expect = 4.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 132 LQISPVTSLFFSFGLAWNCRP 70 L + V++LFFS G+ W+ RP Sbjct: 112 LSVPTVSALFFSIGIGWSTRP 132
>EFP_RHOBA (Q7UXN7) Elongation factor P (EF-P)| Length = 195 Score = 27.7 bits (60), Expect = 8.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 98 EKNNDVTGDIWRYNGDSLVCS 160 E N+V GDIW+Y D CS Sbjct: 100 EVPNEVAGDIWKYLKDGTECS 120 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,136,927 Number of Sequences: 219361 Number of extensions: 618773 Number of successful extensions: 1767 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1767 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)