| Clone Name | rbaal38o12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATKA_PSEPK (Q88FD7) Potassium-transporting ATPase A chain (EC 3.... | 29 | 6.5 | 2 | NET2_HUMAN (O00634) Netrin-2-like protein precursor | 29 | 8.5 |
|---|
>ATKA_PSEPK (Q88FD7) Potassium-transporting ATPase A chain (EC 3.6.3.12)| (Potassium-translocating ATPase A chain) (ATP phosphohydrolase [potassium-transporting] A chain) (Potassium-binding and translocating subunit A) Length = 564 Score = 29.3 bits (64), Expect = 6.5 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 5/52 (9%) Frame = -1 Query: 509 AMVWDIYT--AXDKLEXAVRDSVNALT---AVVNLEVGEIVTTAVEAGFVAL 369 +++W + T A + A+ DS+N LT A+VN+ VGE++ V AG + Sbjct: 336 SVLWAVTTTAASNGSVNAMHDSLNPLTGMVAMVNMMVGEVIFGGVGAGLYGM 387
>NET2_HUMAN (O00634) Netrin-2-like protein precursor| Length = 580 Score = 28.9 bits (63), Expect = 8.5 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = -3 Query: 402 YYCCRSWIRST---RHXNCXCGCHGNWRSRRF 316 +YC R W R+T H C C+G+ R RF Sbjct: 291 FYCDRPWQRATARESHACLACSCNGHARRCRF 322 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,599,640 Number of Sequences: 219361 Number of extensions: 636808 Number of successful extensions: 1151 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1151 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)