| Clone Name | rbaal39d08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EXOC2_ARATH (Q8S3U9) Exocyst complex component 2 (Exocyst comple... | 72 | 1e-12 | 2 | HXA9B_BRARE (Q9YGT5) Homeobox protein Hox-A9b | 33 | 0.44 | 3 | PTPRZ_RAT (Q62656) Receptor-type tyrosine-protein phosphatase ze... | 31 | 2.2 |
|---|
>EXOC2_ARATH (Q8S3U9) Exocyst complex component 2 (Exocyst complex component Sec5)| Length = 1090 Score = 72.0 bits (175), Expect = 1e-12 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = -2 Query: 573 RQPTRGSEDAASDDKQVSSVSPDDLLALAQQHGSDLLQGELERTRLNIACFMES 412 R+PTRGSED SDDKQ SVS DDLLAL +Q ++LLQ ELERTR+N ACF ES Sbjct: 994 RRPTRGSEDTVSDDKQ--SVSADDLLALTKQCSNELLQQELERTRVNTACFAES 1045
>HXA9B_BRARE (Q9YGT5) Homeobox protein Hox-A9b| Length = 258 Score = 33.5 bits (75), Expect = 0.44 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = -3 Query: 365 HQHQQHIIPRLKSPPLVLEGSRQVQILP*SLEDADELTAESNIF 234 H++ H+ PR S P+V + SR++ +L S ++ A+S+IF Sbjct: 17 HENDDHLAPRFSSGPVVQQQSRELTLLEYSEQEPYTFQAKSSIF 60
>PTPRZ_RAT (Q62656) Receptor-type tyrosine-protein phosphatase zeta precursor| (EC 3.1.3.48) (R-PTP-zeta) (Phosphacan) (3F8 chondroitin sulfate proteoglycan) (3H1 keratan sulfate proteoglycan) Length = 2316 Score = 31.2 bits (69), Expect = 2.2 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 10/72 (13%) Frame = -2 Query: 573 RQPTRGSEDAASDD----------KQVSSVSPDDLLALAQQHGSDLLQGELERTRLNIAC 424 R PTRGSE + D +QV+ +P+ ++L Q G++L +E T Sbjct: 481 RSPTRGSEFSGKSDVLNTSLNPTSQQVAEFNPEREMSLPSQIGTNLPPHSVEGT------ 534 Query: 423 FMESTLQSGSKT 388 ++L SGSKT Sbjct: 535 --SASLNSGSKT 544 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,830,008 Number of Sequences: 219361 Number of extensions: 1325951 Number of successful extensions: 3354 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3352 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)