| Clone Name | rbaal38o06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TAT_HV1SC (P05906) TAT protein (Transactivating regulatory protein) | 28 | 7.9 |
|---|
>TAT_HV1SC (P05906) TAT protein (Transactivating regulatory protein)| Length = 101 Score = 27.7 bits (60), Expect = 7.9 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +2 Query: 56 DVRLNWLPHAGWKKTAWTSGCFQCHACSAIGQGRTRTTGLGIFHGGQRRR 205 D RL H G + A + C+ C C Q T GLGI +G ++RR Sbjct: 5 DPRLEPWKHPGSQPKAACTSCY-CKKCCFHCQVCFTTKGLGISYGRKKRR 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,432,582 Number of Sequences: 219361 Number of extensions: 791056 Number of successful extensions: 1896 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1896 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)