| Clone Name | rbaal39d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ACOD2_RAT (Q6P7B9) Acyl-CoA desaturase 2 (EC 1.14.19.1) (Stearoy... | 31 | 4.2 | 2 | MSHR_FELCA (Q865E9) Melanocyte-stimulating hormone receptor (MSH... | 30 | 5.5 |
|---|
>ACOD2_RAT (Q6P7B9) Acyl-CoA desaturase 2 (EC 1.14.19.1) (Stearoyl-CoA| desaturase 2) (Fatty acid desaturase 2) (Delta(9)-desaturase 2) Length = 358 Score = 30.8 bits (68), Expect = 4.2 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -3 Query: 600 RPIVACLLFHISALCGVTQTSNCGIVYCFI*ALYVVL 490 R IV L HI AL G+T +C + C LY V+ Sbjct: 73 RNIVLMALLHIGALYGITLVPSCKVYTCLFAYLYYVI 109
>MSHR_FELCA (Q865E9) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 317 Score = 30.4 bits (67), Expect = 5.5 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -3 Query: 507 ALYVVLLRRPTVACIFFNYSALSSLLVYKSLMETF-HIFMNASLN*TILGRYYC*W 343 +L V+ R P C+F N++ +L++ S+++ F + F + L T+ C W Sbjct: 262 SLMVLCPRHPICGCVFKNFNLFLTLIICNSIVDPFIYAFRSQELRKTLQEVLLCSW 317 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,137,801 Number of Sequences: 219361 Number of extensions: 2105089 Number of successful extensions: 4414 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4414 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7082949625 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)