| Clone Name | rbaal8j02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RAD50_MOUSE (P70388) DNA repair protein RAD50 (EC 3.6.-.-) (mRad50) | 31 | 2.1 | 2 | ERD10_ARATH (P42759) Dehydrin ERD10 (Low-temperature-induced pro... | 30 | 3.6 | 3 | Y1617_METMA (Q8PWH0) UPF0272 protein MM1617 | 30 | 4.6 | 4 | KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-ass... | 30 | 6.1 | 5 | AMPC_SERMA (P18539) Beta-lactamase precursor (EC 3.5.2.6) (Cepha... | 29 | 7.9 |
|---|
>RAD50_MOUSE (P70388) DNA repair protein RAD50 (EC 3.6.-.-) (mRad50)| Length = 1312 Score = 31.2 bits (69), Expect = 2.1 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 4/77 (5%) Frame = -2 Query: 476 RHV*HNFKMLK----KLLKVTSEVTERELELEAQLVEARSIIQEQASIMSKHFSKSDKPR 309 RHV + L+ ++L++ E+T+ E EL ++ + SI +A +MS K+D R Sbjct: 458 RHVRSELQQLEGSSDRILELDQELTKAEREL-SKAEKNSSIETLKAEVMSLQNEKADLDR 516 Query: 308 RLSGLDAEHEAIHSAST 258 L LD E E ++ +T Sbjct: 517 SLRKLDQEMEQLNHHTT 533
>ERD10_ARATH (P42759) Dehydrin ERD10 (Low-temperature-induced protein LTI45)| Length = 260 Score = 30.4 bits (67), Expect = 3.6 Identities = 20/68 (29%), Positives = 29/68 (42%) Frame = -2 Query: 437 LKVTSEVTERELELEAQLVEARSIIQEQASIMSKHFSKSDKPRRLSGLDAEHEAIHSAST 258 LK EV +E A E ++ I E S ++KH + KP L L +HE Sbjct: 36 LKKKEEVKPQETTTLASEFEHKTQISEPESFVAKHEEEEHKPTLLEQLHQKHEEEEENKP 95 Query: 257 DV*RYIHR 234 + +HR Sbjct: 96 SLLDKLHR 103
>Y1617_METMA (Q8PWH0) UPF0272 protein MM1617| Length = 396 Score = 30.0 bits (66), Expect = 4.6 Identities = 17/65 (26%), Positives = 31/65 (47%) Frame = -2 Query: 449 LKKLLKVTSEVTERELELEAQLVEARSIIQEQASIMSKHFSKSDKPRRLSGLDAEHEAIH 270 L K K+ S+V L++ ++ EA + + Q + HF + + L+ + AIH Sbjct: 77 LVKASKLPSKVEASALDIFLKMAEAEAAVHGQPDLEKLHFHEVGQSDALADVIGSSAAIH 136 Query: 269 SASTD 255 S + D Sbjct: 137 SLNCD 141
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 29.6 bits (65), Expect = 6.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 31 IPVAGCHTCGIIS*QRQERCSCVSCYIGCGNHGGKR 138 +P C +CG + SC C GCG+ GG + Sbjct: 49 VPACSCSSCGSCGGSKGVCGSCGGCKGGCGSCGGSK 84
>AMPC_SERMA (P18539) Beta-lactamase precursor (EC 3.5.2.6) (Cephalosporinase)| Length = 376 Score = 29.3 bits (64), Expect = 7.9 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = -2 Query: 377 ARSIIQEQASIMSKH---FSKSDKPRRLSG--LDAEHEAIHSASTDV*RYIHREFQF*KA 213 + + +Q A+ M+ + +SK DKP R++ LDAE I S + D+ RY+ Q K Sbjct: 199 SHTYVQVPAAQMANYAQGYSKDDKPVRVNPGPLDAESYGIKSNARDLIRYLDANLQQVKV 258 Query: 212 A 210 A Sbjct: 259 A 259 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,055,460 Number of Sequences: 219361 Number of extensions: 1276556 Number of successful extensions: 2974 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2972 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)