| Clone Name | rbaal39b13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LMO6_MOUSE (Q80VL3) LIM domain only protein 6 (Triple LIM domain... | 29 | 3.6 | 2 | V2R_RAT (Q00788) Vasopressin V2 receptor (Renal-type arginine va... | 28 | 8.1 |
|---|
>LMO6_MOUSE (Q80VL3) LIM domain only protein 6 (Triple LIM domain protein 6)| Length = 624 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 58 LEICTLACRSGPPTVLPGAARRLWNA 135 L C+ AC G T PG RR W+A Sbjct: 359 LIFCSRACSLGSETTAPGPGRRSWSA 384
>V2R_RAT (Q00788) Vasopressin V2 receptor (Renal-type arginine vasopressin| receptor) (Antidiuretic hormone receptor) (AVPR V2) Length = 371 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 129 PQPPCSARQDGRRTGPACEGANLKFLLANHILAVLVV 19 P R+ GRRTG EGA++ +A + LV+ Sbjct: 240 PSERAGRRRRGRRTGSPSEGAHVSAAMAKTVRMTLVI 276 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,558,398 Number of Sequences: 219361 Number of extensions: 392020 Number of successful extensions: 876 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 876 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)