| Clone Name | rbaal39b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CX036_HUMAN (Q9H7Y0) Protein CXorf36 precursor | 28 | 5.0 | 2 | ORN_VIBCH (Q9KV17) Oligoribonuclease (EC 3.1.-.-) | 28 | 6.5 | 3 | CD22_MOUSE (P35329) B-cell receptor CD22 precursor (Leu-14) (B-l... | 28 | 8.5 |
|---|
>CX036_HUMAN (Q9H7Y0) Protein CXorf36 precursor| Length = 182 Score = 28.5 bits (62), Expect = 5.0 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +2 Query: 86 RPVKSMR*--KYRKEILRGRLCVSLSTPRTTNVLYVQVKVQ*F 208 RPV+ R KY+ EI R+C S S P+T ++ V K + F Sbjct: 109 RPVEIFRLVSKYQNEISDRRICASASAPKTCSIERVLRKTERF 151
>ORN_VIBCH (Q9KV17) Oligoribonuclease (EC 3.1.-.-)| Length = 181 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 138 LPRSISFLYFYRIDFTGLKRLGRKWQESVL 49 +PR ++ ++ ID + +K L R+WQ VL Sbjct: 120 MPRLEAYFHYRYIDVSTIKELTRRWQPEVL 149
>CD22_MOUSE (P35329) B-cell receptor CD22 precursor (Leu-14) (B-lymphocyte cell| adhesion molecule) (BL-CAM) (Siglec-2) Length = 862 Score = 27.7 bits (60), Expect = 8.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 113 IFTASILPASKDWEENGRSLSCSTYEHSKYXSRRT 9 ++T S L W ++G+S+ C S+ S RT Sbjct: 208 VYTESKLTFQPKWTDHGKSVKCQVQHSSEVLSERT 242 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,637,537 Number of Sequences: 219361 Number of extensions: 459575 Number of successful extensions: 1203 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1203 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)