| Clone Name | rbaal39b03 |
|---|---|
| Clone Library Name | barley_pub |
>PGBM_HUMAN (P98160) Basement membrane-specific heparan sulfate proteoglycan core| protein precursor (HSPG) (Perlecan) (PLC) Length = 4391 Score = 31.6 bits (70), Expect = 1.1 Identities = 19/60 (31%), Positives = 29/60 (48%) Frame = +3 Query: 243 HHRGGALYSPAKPKENSPKGRLLALPAVDAGPYFETQHENHGRDKEEVQAAAQHRWDGAH 422 H RGG+L PA+ + + + RLL + D+G Y + G + V Q R G+H Sbjct: 2471 HKRGGSL--PARHQVHGSRLRLLQVTPADSGEYVCRVVGSSGTQEASVLVTIQQRLSGSH 2528
>RPOA_DEHSC (Q3ZZP6) DNA-directed RNA polymerase alpha chain (EC 2.7.7.6) (RNAP| alpha subunit) (Transcriptase alpha chain) (RNA polymerase alpha subunit) Length = 330 Score = 29.3 bits (64), Expect = 5.6 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = +1 Query: 313 LYLL*MQDPTLKLNMRIMAETKKRYRPPRSTVGTVLTRVVAGSSSKPINFVD 468 LYLL + LN+ + E + YRPP S T + + + PI V+ Sbjct: 123 LYLLTLDSDDAVLNVELEVELGRGYRPPESAENTPIGTIPVDAIFTPIRKVN 174
>Y115_ADE02 (P03290) Hypothetical protein E-115| Length = 115 Score = 28.9 bits (63), Expect = 7.3 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 362 SWPRQRRGTGRRAAPLGRCSPV*WLARRRNQSTS 463 +WP +R TG +AP G S W AR ++ S Sbjct: 81 TWPTRRAKTGSASAPAGPASSAPWPARSPERTPS 114
>PK1L1_MOUSE (Q8R526) Polycystic kidney disease 1-like 1 protein| (Polycystin-1L1) (Fragment) Length = 531 Score = 28.5 bits (62), Expect = 9.6 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = -1 Query: 333 LHLQQVKLR---ACPWGCF--LLV*RDYTRRPLDDGEGATTXRSFTFTLL 199 LH Q++ + C + C L+ RD+ +RPLD G A T F LL Sbjct: 226 LHTQRLAVSFCLLCVYSCLTALVTVRDHQQRPLDVGPTAITLEPFCMALL 275
>PRMA_SYNEL (Q8DM00) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 299 Score = 28.5 bits (62), Expect = 9.6 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = +2 Query: 2 MVYNXVTSFGLPNTQSSDQMNRINYRS*MKHKGLSTERVQATGLSPVQELIALLYLSP 175 +VY + SFG T + Q R+ + + + +S + A G+ Q+++A YLSP Sbjct: 19 LVYWRLQSFGCQGTATQLQQGRVLIQGYVPQQRVSLLDIAALGVWIEQDVVAQGYLSP 76 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,537,187 Number of Sequences: 219361 Number of extensions: 1383906 Number of successful extensions: 3395 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3395 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)