| Clone Name | rbaal39a13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | INV1_MAIZE (P49175) Beta-fructofuranosidase 1 precursor (EC 3.2.... | 28 | 6.8 |
|---|
>INV1_MAIZE (P49175) Beta-fructofuranosidase 1 precursor (EC 3.2.1.26) (Sucrose| 1) (Invertase 1) Length = 670 Score = 28.1 bits (61), Expect = 6.8 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 174 FNNATGARVTTTSLVIHEMDSSYNQAYTAS 85 FNNAT A V S+ I +++S+Y + Y A+ Sbjct: 637 FNNATHAHVKAKSVKIWQLNSAYIRPYPAT 666 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.141 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,869,550 Number of Sequences: 219361 Number of extensions: 193837 Number of successful extensions: 344 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 344 length of database: 80,573,946 effective HSP length: 34 effective length of database: 73,115,672 effective search space used: 1754776128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)