| Clone Name | rbaal38k10 |
|---|---|
| Clone Library Name | barley_pub |
>INV1_MAIZE (P49175) Beta-fructofuranosidase 1 precursor (EC 3.2.1.26) (Sucrose| 1) (Invertase 1) Length = 670 Score = 37.0 bits (84), Expect = 0.015 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = -1 Query: 162 AIYANAGVYLFNNXTGARVTTTSLVIXEMDSSYNQAYTAS 43 AIY +A V+LFNN T A V S+ I +++S+Y + Y A+ Sbjct: 627 AIYDSARVFLFNNATHAHVKAKSVKIWQLNSAYIRPYPAT 666
>INVA_PHAVU (O24509) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 651 Score = 31.2 bits (69), Expect = 0.81 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = -1 Query: 165 EAIYANAGVYLFNNXTGARVTTTSLVIXEMDSSY 64 +AIY A ++LFNN T A V T SL I +M+S++ Sbjct: 607 KAIYGAARLFLFNNATEATV-TASLKIWQMNSAF 639
>INVA_PHAAU (P29001) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) [Contains: Acid beta-fructofuranosidase 30 kDa subunit; Acid beta-fructofuranosidase 38 kDa subunit] Length = 649 Score = 30.8 bits (68), Expect = 1.1 Identities = 16/34 (47%), Positives = 24/34 (70%) Frame = -1 Query: 165 EAIYANAGVYLFNNXTGARVTTTSLVIXEMDSSY 64 +AIY A ++LFNN T A V T SL + +M+S++ Sbjct: 605 KAIYGAARLFLFNNATEATV-TASLKVWQMNSAF 637
>INVB_DAUCA (P80065) Beta-fructofuranosidase, soluble isoenzyme I precursor (EC| 3.2.1.26) (Sucrose hydrolase) (Invertase) (Saccharase) Length = 661 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 162 AIYANAGVYLFNNXTGARVTTT 97 AIY+ A V+LFNN TG VT + Sbjct: 621 AIYSAARVFLFNNATGVSVTAS 642
>INVA_VICFA (Q43857) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 642 Score = 28.5 bits (62), Expect = 5.2 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -1 Query: 162 AIYANAGVYLFNNXTGARVTTTSLVIXEMDSSYNQAY 52 AIY A ++LFNN V T SL + +M+S++ + Y Sbjct: 598 AIYGAARLFLFNNAIETNV-TASLKVWQMNSAFIRPY 633 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.146 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,778,968 Number of Sequences: 219361 Number of extensions: 154886 Number of successful extensions: 263 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 263 length of database: 80,573,946 effective HSP length: 30 effective length of database: 73,993,116 effective search space used: 1775834784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)