| Clone Name | rbaal38g04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | WECB_ECOLI (P27828) UDP-N-acetylglucosamine 2-epimerase (EC 5.1.... | 28 | 5.0 | 2 | WECB_ECO57 (Q8XAR8) UDP-N-acetylglucosamine 2-epimerase (EC 5.1.... | 28 | 5.0 | 3 | PEPX_STRA5 (Q8DXW0) Xaa-Pro dipeptidyl-peptidase (EC 3.4.14.11) ... | 28 | 8.6 | 4 | PEPX_STRA3 (Q8E3H8) Xaa-Pro dipeptidyl-peptidase (EC 3.4.14.11) ... | 28 | 8.6 |
|---|
>WECB_ECOLI (P27828) UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14)| (UDP-GlcNAc-2-epimerase) (Bacteriophage N4 adsorption protein C) Length = 376 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +3 Query: 12 LRTGKIYLPYTPSCQQNSVQFTTSHIFYEAIMNHEGIWHFSPTETALLN 158 LRTG +Y P+ + + H ++HFSPTET+ N Sbjct: 120 LRTGDLYSPWPEEANRT-------------LTGHLAMYHFSPTETSRQN 155
>WECB_ECO57 (Q8XAR8) UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14)| (UDP-GlcNAc-2-epimerase) (Bacteriophage N4 adsorption protein C) Length = 376 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +3 Query: 12 LRTGKIYLPYTPSCQQNSVQFTTSHIFYEAIMNHEGIWHFSPTETALLN 158 LRTG +Y P+ + + H ++HFSPTET+ N Sbjct: 120 LRTGDLYSPWPEEANRT-------------LTGHLAMYHFSPTETSRQN 155
>PEPX_STRA5 (Q8DXW0) Xaa-Pro dipeptidyl-peptidase (EC 3.4.14.11) (X-Pro| dipeptidyl-peptidase) (X-prolyl-dipeptidyl aminopeptidase) (X-PDAP) Length = 761 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/53 (24%), Positives = 27/53 (50%) Frame = +1 Query: 37 HIHRAASKILYNLQRLTFSMRPS*IMKVFGTLVLQKPHS*TKRVIIHRGASSY 195 H++ S+++Y ++++P + KVF L P + K + +H+G Y Sbjct: 451 HVNNVKSRVVYTHGLQDWNVKPRHVYKVFNAL----PQTIKKHLFLHQGQHVY 499
>PEPX_STRA3 (Q8E3H8) Xaa-Pro dipeptidyl-peptidase (EC 3.4.14.11) (X-Pro| dipeptidyl-peptidase) (X-prolyl-dipeptidyl aminopeptidase) (X-PDAP) Length = 761 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/53 (24%), Positives = 27/53 (50%) Frame = +1 Query: 37 HIHRAASKILYNLQRLTFSMRPS*IMKVFGTLVLQKPHS*TKRVIIHRGASSY 195 H++ S+++Y ++++P + KVF L P + K + +H+G Y Sbjct: 451 HVNNVKSRVVYTHGLQDWNVKPRHVYKVFNAL----PQTIKKHLFLHQGQHVY 499 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,687,826 Number of Sequences: 219361 Number of extensions: 455624 Number of successful extensions: 930 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)