| Clone Name | rbaal8i15 |
|---|---|
| Clone Library Name | barley_pub |
>I17RD_HUMAN (Q8NFM7) Interleukin-17 receptor D precursor (IL-17 receptor D)| (IL-17RD) (Interleukin-17D receptor) (IL-17D receptor) (IL17Rhom) (Interleukin-17 receptor-like protein) (Sef homolog) (hSef) Length = 739 Score = 32.7 bits (73), Expect = 0.79 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -3 Query: 236 IGKKMIEDLQELLLSDVYTCYMQDVIMLMWHPGAV 132 +GK +I D Q + +S Y C+ Q + ++W PGA+ Sbjct: 70 VGKHVIADAQNITISQ-YACHDQVAVTILWSPGAL 103
>HTPX_XYLFA (Q9PA93) Probable protease htpX homolog (EC 3.4.24.-)| Length = 289 Score = 32.0 bits (71), Expect = 1.3 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = -2 Query: 378 LLDTVSRTLVTVGSGNP-ICTDVGLSHRA-ETGGKRSDSSVLIDAGLQCNRQEDD 220 LLDTVSR VG G P I G+ A TG R+++ V + GL N +D+ Sbjct: 79 LLDTVSRQAEIVGIGRPEIAIYEGVEINAFATGADRNNALVAVSTGLLQNMSQDE 133
>I17RD_MOUSE (Q8JZL1) Interleukin-17 receptor D precursor (IL-17 receptor D)| (IL-17RD) (Interleukin-17D receptor) (IL-17D receptor) (Interleukin-17 receptor-like protein) (Sef homolog) (mSef) Length = 738 Score = 30.8 bits (68), Expect = 3.0 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 233 GKKMIEDLQELLLSDVYTCYMQDVIMLMWHPGAV 132 GK I D Q + +S Y C+ Q + ++W PGA+ Sbjct: 71 GKHAIADAQNITISQ-YACHDQVAVTILWSPGAL 103
>RAGE_BOVIN (Q28173) Advanced glycosylation end product-specific receptor| precursor (Receptor for advanced glycosylation end products) Length = 416 Score = 30.8 bits (68), Expect = 3.0 Identities = 27/112 (24%), Positives = 46/112 (41%) Frame = -2 Query: 417 YRAAVYKAKRNPALLDTVSRTLVTVGSGNPICTDVGLSHRAETGGKRSDSSVLIDAGLQC 238 YR VY+ P ++D S + V + C G + A T D LI G Sbjct: 112 YRVRVYQIPGKPEIVDPASELMAGVPNKVGTCVSEG-GYPAGTLNWLLDGKTLIPDGKGV 170 Query: 237 NRQEDDRRLARATTIRCVYLLHARCNYVNVASGRSYQLRVTVALCYTPSVPK 82 + +E+ +R + ++ LH+ + V R L T + +TP +P+ Sbjct: 171 SVKEETKRHPKTG----LFTLHSE---LMVTPARGGALHPTFSCSFTPGLPR 215
>I17RD_CHICK (Q7T2L7) Interleukin-17 receptor D precursor (IL-17 receptor D)| (IL-17RD) (Interleukin-17D receptor) (IL-17D receptor) (Sef homolog) (cSEF) Length = 741 Score = 30.4 bits (67), Expect = 3.9 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 236 IGKKMIEDLQELLLSDVYTCYMQDVIMLMWHPGAV 132 +GK +I D+Q + +S Y CY Q + ++W A+ Sbjct: 72 VGKHVIGDVQNITISQ-YACYEQVAVTILWTANAI 105
>EKC1_SCHPO (O74511) Extragenic suppressor of kinetochore protein 1| Length = 838 Score = 30.0 bits (66), Expect = 5.1 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = +1 Query: 331 ISRSNSYQRTTNRVQQGRVSLSLIYGSAIEVTSAKPSRPSAMEAGY 468 + + +Y + +QG+++ ++YG E+ K ++PS AGY Sbjct: 558 MDKDQNYALAVDMFKQGKITEKIVYGQ--ELNDKKVAKPSGFRAGY 601 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,047,185 Number of Sequences: 219361 Number of extensions: 1466053 Number of successful extensions: 2878 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2878 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5044307840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)