| Clone Name | rbaal38c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YKY7_YEAST (Q02205) Hypothetical 20.2 kDa protein in MRPL13-FOX2... | 28 | 4.2 | 2 | YCF2_PANGI (Q68RU4) Protein ycf2 | 28 | 7.1 |
|---|
>YKY7_YEAST (Q02205) Hypothetical 20.2 kDa protein in MRPL13-FOX2 intergenic| region Length = 184 Score = 28.5 bits (62), Expect = 4.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 282 SCLRNHLGEERHIMVIRQKEGY 217 SC RNH GEE ++ Q+ GY Sbjct: 6 SCCRNHSGEENEALLREQQAGY 27
>YCF2_PANGI (Q68RU4) Protein ycf2| Length = 2110 Score = 27.7 bits (60), Expect = 7.1 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 6/61 (9%) Frame = +1 Query: 82 SAPYYYQSYGPISIPKNLI*IFE--APTEILCICFLYQV---FKFLSPWCIAFL-LADDH 243 S P+++ S+G I I ++ I I+E P + LC L + L W L L DDH Sbjct: 682 SLPFFFVSFGNIPIHRSEIYIYELKGPNDQLCNQLLESIGLQIVHLKKWKPFLLDLLDDH 741 Query: 244 D 246 D Sbjct: 742 D 742 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,848,929 Number of Sequences: 219361 Number of extensions: 1042723 Number of successful extensions: 1786 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1786 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)