| Clone Name | rbaal38b02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CSF1R_RAT (Q00495) Macrophage colony-stimulating factor 1 recept... | 31 | 3.6 | 2 | CSF1R_MOUSE (P09581) Macrophage colony-stimulating factor 1 rece... | 31 | 3.6 |
|---|
>CSF1R_RAT (Q00495) Macrophage colony-stimulating factor 1 receptor precursor| (CSF-1-R) (EC 2.7.10.1) (Fms proto-oncogene) (c-fms) Length = 978 Score = 30.8 bits (68), Expect = 3.6 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +1 Query: 94 PRSPFG*LTPYTP--ILASVNGTICSTGTYICQRVSMPSATSLTAEVNQK 237 P SP+ L P +P L + N T +TGTY C + P A S T + K Sbjct: 53 PISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVK 102
>CSF1R_MOUSE (P09581) Macrophage colony-stimulating factor 1 receptor precursor| (CSF-1-R) (EC 2.7.10.1) (Fms proto-oncogene) (c-fms) Length = 977 Score = 30.8 bits (68), Expect = 3.6 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +1 Query: 94 PRSPFG*LTPYTP--ILASVNGTICSTGTYICQRVSMPSATSLTAEVNQK 237 P SP+ L P +P L + N T +TGTY C + P A S T + K Sbjct: 53 PISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVK 102 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,377,391 Number of Sequences: 219361 Number of extensions: 1930678 Number of successful extensions: 4207 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4207 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)