| Clone Name | rbaal8i02 |
|---|---|
| Clone Library Name | barley_pub |
>SYS_ARATH (Q39230) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 451 Score = 44.7 bits (104), Expect = 2e-04 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = -1 Query: 620 KDGVEVPKALQPFMGGIDFLPFK-RPLDSKQAADSKPNKSK 501 +DGV++P+ LQPFMGG FLPFK +P+ AD+K KSK Sbjct: 414 EDGVDIPEVLQPFMGGETFLPFKAKPV----VADTKGKKSK 450
>SYSC_SCHPO (O14018) Seryl-tRNA synthetase, cytoplasmic (EC 6.1.1.11)| (Serine--tRNA ligase) (SerRS) Length = 450 Score = 40.4 bits (93), Expect = 0.004 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -1 Query: 617 DGVEVPKALQPFMGGIDFLPFKRPLDSKQAADSKPN 510 DGV VPK LQP+MGG FLPF + L + N Sbjct: 415 DGVNVPKVLQPYMGGKTFLPFTKELPKNSTSKKGKN 450
>SYS_HELAN (O81983) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 438 Score = 32.0 bits (71), Expect = 1.5 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 614 GVEVPKALQPFMGGIDFLPFKRPL 543 GV +P+ LQPFMGG FL F + + Sbjct: 413 GVAIPEVLQPFMGGKTFLDFLKKI 436
>COR1A_HUMAN (P31146) Coronin-1A (Coronin-like protein p57) (Coronin-like| protein A) (CLIPINA) (Tryptophan aspartate-containing coat protein) (TACO) Length = 461 Score = 29.6 bits (65), Expect = 7.5 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -3 Query: 201 WHNPASGL---IRDSTEDLHGRAVRIGFPFWLFCLQNIAIQAACSH 73 W P GL +R+ L G R+G W QN+ + A C + Sbjct: 109 WEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDN 154
>COR2B_HUMAN (Q9UQ03) Coronin-2B (Coronin-like protein C) (ClipinC) (Protein| FC96) Length = 475 Score = 29.3 bits (64), Expect = 9.8 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 201 WHNPASGLIRDSTE---DLHGRAVRIGFPFWLFCLQNIAIQA 85 W P GL R+ TE +LHG + R+G W NI A Sbjct: 110 WEIPEGGLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSA 151 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,552,020 Number of Sequences: 219361 Number of extensions: 2007786 Number of successful extensions: 4457 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4457 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)