| Clone Name | rbaal37j19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CBX4_HUMAN (O00257) Chromobox protein homolog 4 (Polycomb 2 homo... | 29 | 9.7 |
|---|
>CBX4_HUMAN (O00257) Chromobox protein homolog 4 (Polycomb 2 homolog) (Pc2)| (hPc2) Length = 558 Score = 28.9 bits (63), Expect = 9.7 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 310 ERPR*QTQVLAIHQFSSYFLTSDLDKPLNLDLIKSMKPTRHQPS 441 ERP A+ Q L SDLD+P++L +KS PS Sbjct: 444 ERPADLPPAAALRQPEVILLDSDLDEPIDLRSVKSRSEAGEPPS 487 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,042,323 Number of Sequences: 219361 Number of extensions: 1483400 Number of successful extensions: 3372 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3372 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)