| Clone Name | rbaal37h14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ARHGB_RAT (Q9ES67) Rho guanine nucleotide exchange factor 11 (Rh... | 29 | 2.9 | 2 | UBQL3_MOUSE (Q8C5U9) Ubiquilin-3 | 28 | 5.0 |
|---|
>ARHGB_RAT (Q9ES67) Rho guanine nucleotide exchange factor 11 (RhoGEF| glutamate transport modulator GTRAP48) Length = 1527 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +3 Query: 3 PPSEAMGESTRTKFTTGTLRLQHVFALPPTPPHFVHPQH 119 PPS + + G LR+ + PP PP PQH Sbjct: 141 PPSVGVSGLQQNPSVAGVLRVNPIIPPPPPPPPLPPPQH 179
>UBQL3_MOUSE (Q8C5U9) Ubiquilin-3| Length = 658 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +2 Query: 74 FCTATYSSTLCTSSAP-QNNNSDHLKPPWS 160 F TAT +ST TSS P + N D L PW+ Sbjct: 278 FVTATTASTTTTSSQPSRTENCDPLPNPWT 307 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,186,440 Number of Sequences: 219361 Number of extensions: 584975 Number of successful extensions: 1800 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1800 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)