| Clone Name | rbaal37f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IGHG3_HUMAN (P01860) Ig gamma-3 chain C region (Heavy chain dise... | 36 | 0.13 | 2 | MLL3_HUMAN (Q8NEZ4) Myeloid/lymphoid or mixed-lineage leukemia p... | 33 | 0.64 | 3 | LYPD3_HUMAN (O95274) Ly6/PLAUR domain-containing protein 3 precu... | 33 | 0.84 | 4 | NO20_MEDTR (P93329) Early nodulin 20 precursor (N-20) | 31 | 4.2 |
|---|
>IGHG3_HUMAN (P01860) Ig gamma-3 chain C region (Heavy chain disease protein)| (HDC) Length = 290 Score = 35.8 bits (81), Expect = 0.13 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -1 Query: 307 PDPSTRNRTLRTPPTHPRCSATR---TPTPAPSCELPRQCDEHDAKPRLAA 164 P+P ++ TPP PRC + TP P P C P+ CD PR A Sbjct: 28 PEP----KSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPA 74 Score = 30.8 bits (68), Expect = 4.2 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -1 Query: 283 TLRTPPTHPRCSATRTPTPAPSCELPRQCDEHDAKPR 173 T T P P + TP P P C P+ CD PR Sbjct: 20 TTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPR 56
>MLL3_HUMAN (Q8NEZ4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to ALR protein) Length = 4911 Score = 33.5 bits (75), Expect = 0.64 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 301 PSTRNRTLRTPPTHPRCSATRTPTPAPSCELPRQCDEHDAKP 176 PST + + PPT T TP + ELP+Q D+ +P Sbjct: 3622 PSTPHSDITAPPTPGISETTSTPAVSTPSELPQQADQESVEP 3663
>LYPD3_HUMAN (O95274) Ly6/PLAUR domain-containing protein 3 precursor| (GPI-anchored metastasis-associated protein C4.4A homolog) (Matrigel-induced gene C4 protein) (MIG-C4) Length = 346 Score = 33.1 bits (74), Expect = 0.84 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 7/64 (10%) Frame = -1 Query: 307 PDPSTRNRT--LRTPPTHP-RCSATRTPTPAPSCELPRQCDEHDA----KPRLAAAVSTI 149 P+P+T T + T + P R ++T P PAP+ + PRQ EH+A +PRL + Sbjct: 244 PEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGH 303 Query: 148 KPRS 137 + RS Sbjct: 304 QDRS 307
>NO20_MEDTR (P93329) Early nodulin 20 precursor (N-20)| Length = 268 Score = 30.8 bits (68), Expect = 4.2 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -1 Query: 307 PDPSTRNRTLRTPPTHPRCSATRTPTPAPS-CELPRQCDEHDAKPRLAAAVSTIKPRS 137 P PS TP HPR + +P+P+PS + P + P + +V+++ P S Sbjct: 171 PSPSPSPSPRSTPIPHPRKRSPASPSPSPSLSKSPSPSESPSLAPSPSDSVASLAPSS 228 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,714,372 Number of Sequences: 219361 Number of extensions: 987175 Number of successful extensions: 3832 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3780 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7026286028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)