| Clone Name | rbaal37e12 |
|---|---|
| Clone Library Name | barley_pub |
>GSCB_XENLA (P53546) Homeobox protein goosecoid isoform B| Length = 243 Score = 31.2 bits (69), Expect = 2.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 339 GPQTFDTAVGPLCCGAEQGAGTDHSRCSAQA 431 G T VGP CCGA Q GT C A Sbjct: 75 GQLHLQTPVGPSCCGAVQALGTQQCSCVPSA 105
>ZN295_HUMAN (Q9ULJ3) Zinc finger protein 295 (Zinc finger and BTB| domain-containing protein 21) Length = 1066 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 125 AVQRHNLLRHNSN*LIPSENNNGPILRHN 39 ++ RH + HN N + P+EN + P+L HN Sbjct: 789 SIWRHQVEVHNQNNMAPTENFSLPVLDHN 817
>A1AT_RAT (P17475) Alpha-1-antiproteinase precursor (Alpha-1-antitrypsin)| (Alpha-1-proteinase inhibitor) Length = 411 Score = 29.6 bits (65), Expect = 6.9 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 298 ACMKRLYGLAAAGIRLRGSTMATALP*SVPPQVKF 194 A K + L G G+T+ A+P S+PPQVKF Sbjct: 350 AVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKF 384
>ANR11_HUMAN (Q6UB99) Ankyrin repeat domain-containing protein 11 (Ankyrin| repeat-containing cofactor 1) Length = 2664 Score = 29.3 bits (64), Expect = 9.1 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = +3 Query: 216 DHGRAVAIVDPRKRIPAAARPYK--RFMQATFFP--ADVDRHPASGPQTFDTAVGP 371 D GR + P K+ P P+K + ++T P A+ HPASG + D GP Sbjct: 1629 DDGRKKGLDIPAKKPPGLDPPFKDKKLKESTPIPPAAENKLHPASGADSKDWLAGP 1684
>ACL7B_MOUSE (Q9QY83) Actin-like protein 7B (Actin-like-7-beta) (Actin-like 7B)| (T-actin-1) (Testis-specific actin-1) Length = 418 Score = 29.3 bits (64), Expect = 9.1 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +2 Query: 359 CRGATLLRGRAGSRYRSLPVLCTSISHNAAGNP-KFASIWNGGCAVNKL 502 C G T+L G R L +LC S A P + S+W GG + L Sbjct: 345 CGGCTMLDGFPERFQRELSLLCPGDSPTVAAAPERKTSVWTGGSILASL 393 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,519,470 Number of Sequences: 219361 Number of extensions: 1935519 Number of successful extensions: 5007 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4872 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5007 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)