| Clone Name | rbaal37e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUOM_BUCAI (P57263) NADH-quinone oxidoreductase chain M (EC 1.6.... | 31 | 3.9 | 2 | RPA1_MOUSE (O35134) DNA-directed RNA polymerase I largest subuni... | 30 | 5.1 | 3 | TAO1A_XENLA (Q6NU21) Serine/threonine-protein kinase TAO1-A (EC ... | 30 | 6.6 | 4 | SRCH_RABIT (P16230) Sarcoplasmic reticulum histidine-rich calciu... | 30 | 6.6 |
|---|
>NUOM_BUCAI (P57263) NADH-quinone oxidoreductase chain M (EC 1.6.99.5) (NADH| dehydrogenase I, chain M) (NDH-1, chain M) Length = 505 Score = 30.8 bits (68), Expect = 3.9 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = -2 Query: 629 FLGDFMSLTGALSTFPLTFVLANHMYLVSNRQRLSSLQKSWH 504 F+G+F+ L+G FPL +LA + S+ L+ +QK ++ Sbjct: 403 FIGEFLILSGVFEVFPLVSILATIGIVFSSIYSLNVIQKIFY 444
>RPA1_MOUSE (O35134) DNA-directed RNA polymerase I largest subunit (EC 2.7.7.6)| (RNA polymerase I 194 kDa subunit) (RPA194) Length = 1717 Score = 30.4 bits (67), Expect = 5.1 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 546 DEVHMVGEHEGERECAERPSEAHEVPQEGQHRGHE 650 +EV E EGE E E E + +G H+GHE Sbjct: 1430 EEVDYESEEEGEEEEEEEVQEEGNIKGDGVHQGHE 1464
>TAO1A_XENLA (Q6NU21) Serine/threonine-protein kinase TAO1-A (EC 2.7.11.1)| (Thousand and one amino acid protein 1-A) Length = 1001 Score = 30.0 bits (66), Expect = 6.6 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +3 Query: 552 VHMVGEHEG---ERECAERPSEAHEVPQEGQHRGHER 653 +H+ E E E E RPSE H PQ +H+ H R Sbjct: 397 IHLKPEEENYPEEPEPRTRPSEPHSPPQVSRHKSHYR 433
>SRCH_RABIT (P16230) Sarcoplasmic reticulum histidine-rich calcium-binding| protein precursor Length = 852 Score = 30.0 bits (66), Expect = 6.6 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +3 Query: 564 GEHEGERECAERPSEAHEVPQEGQHRGHERVDG 662 G E E E + E H VP G HRGHE DG Sbjct: 456 GHGEEEDEDDDDEGEHHHVPHRG-HRGHEEDDG 487 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,913,342 Number of Sequences: 219361 Number of extensions: 1164164 Number of successful extensions: 3176 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3173 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6541540170 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)