| Clone Name | rbaal37d13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YEIB_ECOLI (P25747) Hypothetical protein yeiB | 28 | 9.1 |
|---|
>YEIB_ECOLI (P25747) Hypothetical protein yeiB| Length = 385 Score = 27.7 bits (60), Expect = 9.1 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +2 Query: 38 LYYGMEGYIIMRLVRSGPSLHELGERHVRLAALG 139 L YG+ G I RLVR PS+ L V L +G Sbjct: 109 LAYGLVGLICWRLVRDAPSVKSLFNTGVMLYLVG 142 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,724,074 Number of Sequences: 219361 Number of extensions: 260178 Number of successful extensions: 586 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 585 length of database: 80,573,946 effective HSP length: 22 effective length of database: 75,748,004 effective search space used: 1817952096 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)