| Clone Name | rbaal36n06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UVRA_CLOPE (Q8XNI5) UvrABC system protein A (UvrA protein) (Exci... | 30 | 5.5 | 2 | VGLH_MEHV1 (P36337) Glycoprotein H precursor | 29 | 7.2 | 3 | TRMU_LACAC (Q5FKU0) Probable tRNA (5-methylaminomethyl-2-thiouri... | 29 | 7.2 |
|---|
>UVRA_CLOPE (Q8XNI5) UvrABC system protein A (UvrA protein) (Excinuclease ABC| subunit A) Length = 939 Score = 29.6 bits (65), Expect = 5.5 Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = -3 Query: 297 DVMILVSIVQPLLEEINAILV-KHQLDMLKC 208 DV LV I+Q L++ N ++V +H LDM+KC Sbjct: 866 DVNRLVKILQRLVDGGNTVIVIEHNLDMIKC 896
>VGLH_MEHV1 (P36337) Glycoprotein H precursor| Length = 808 Score = 29.3 bits (64), Expect = 7.2 Identities = 24/106 (22%), Positives = 44/106 (41%), Gaps = 5/106 (4%) Frame = +1 Query: 70 GTNHQQFLKETPTNLHFTMQARLIR-----LCSTVVDMYNHQVIGHPCVSGAFEHVQLVF 234 G + F K+ T HF + I+ L +++ + GH A +H+ L+ Sbjct: 363 GISSAAFRKDAST--HFLISGTPIKDSKADLIKSLLSKVIRPISGHTRPLSAIQHLFLLR 420 Query: 235 NQNGIDLL*QRLYNGDQYHDISSKILRILAAPHQQLNKDLSFWNET 372 + +D+ Q NG +S+ L + H + +D+ WN T Sbjct: 421 SAYALDIPRQ---NGSLSEQVSTVALSFIENIHSEAMRDILSWNTT 463
>TRMU_LACAC (Q5FKU0) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 375 Score = 29.3 bits (64), Expect = 7.2 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 292 HDIGLHCTASARGDQCHFG*TPAGHA 215 HD +HCTA R QC G T HA Sbjct: 301 HDFEMHCTAKFRYRQCDIGVTVKYHA 326 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,524,740 Number of Sequences: 219361 Number of extensions: 1504937 Number of successful extensions: 3013 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3013 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)