| Clone Name | rbaal37c04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRXR2_HUMAN (Q9NNW7) Thioredoxin reductase 2, mitochondrial prec... | 30 | 2.8 | 2 | LAMB_ECOLI (P02943) Maltoporin precursor (Maltose-inducible pori... | 29 | 4.8 | 3 | SFRIP_HUMAN (Q99590) SFRS2-interacting protein (Splicing factor,... | 29 | 6.3 |
|---|
>TRXR2_HUMAN (Q9NNW7) Thioredoxin reductase 2, mitochondrial precursor (EC| 1.8.1.9) (TR3) (TR-beta) (Selenoprotein Z) (SelZ) Length = 524 Score = 30.0 bits (66), Expect = 2.8 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = -3 Query: 436 TNGTSYIXDSASCRTIRLPVGVLPPDWLHGAVYLGRETTDGFDCHLW 296 ++GT ++ A R RLP G L W G+E T FD LW Sbjct: 270 SHGTRFLRGCAPSRVRRLPDGQLQVTWEDSTT--GKEDTGTFDTVLW 314
>LAMB_ECOLI (P02943) Maltoporin precursor (Maltose-inducible porin) (Lambda| receptor protein) Length = 446 Score = 29.3 bits (64), Expect = 4.8 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 5/42 (11%) Frame = +3 Query: 276 QTKSTLVQRWQSKPSVVSRPR*T-----APWSQSGGRTPTGN 386 Q K TL Q+WQ+ S+ SRP A W + G TGN Sbjct: 367 QYKITLAQQWQAGDSIWSRPAIRVFATYAKWDEKWGYDYTGN 408
>SFRIP_HUMAN (Q99590) SFRS2-interacting protein (Splicing factor,| arginine/serine-rich 2-interacting protein) (SC35-interacting protein 1) (CTD-associated SR protein 11) (Splicing regulatory protein 129) (SRrp129) (NY-REN-40 antigen) Length = 1148 Score = 28.9 bits (63), Expect = 6.3 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 7/70 (10%) Frame = +3 Query: 237 QRTGRWVRTSS*YQTKSTLVQRWQSKPSVVSR-------PR*TAPWSQSGGRTPTGNRMV 395 +RT +W R+ S ++S R +SK S R PR W+ G R P GN Sbjct: 612 RRTRKWSRSRS--HSRSPSRCRTKSKSSSFGRIDRDSYSPRWKGRWANDGWRCPRGNDRY 669 Query: 396 RQDAESKM*E 425 R++ K E Sbjct: 670 RKNDPEKQNE 679 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,068,367 Number of Sequences: 219361 Number of extensions: 684016 Number of successful extensions: 2032 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2032 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)