| Clone Name | rbaal37b21 |
|---|---|
| Clone Library Name | barley_pub |
>APLP2_RAT (P15943) Amyloid-like protein 2 precursor (Sperm membrane protein| YWK-II) Length = 765 Score = 30.0 bits (66), Expect = 5.7 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 499 FDYDDSGLPLCQVMVPRPSSPTGCVDAVFITEAD 398 F+ +D + +C+ M+P PT VD F T AD Sbjct: 352 FESEDYCMAVCKTMIPPTPLPTNDVDVYFETSAD 385
>SYFB_PARUW (Q6MEA6) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 799 Score = 30.0 bits (66), Expect = 5.7 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 94 CLGCRNLHVSTMPDWLTACLSTNGVSCISDSQHGENWVKLVSGLP 228 C +N+ V PDWL A + +G+ +++ N+V L G P Sbjct: 220 CRVIKNVKVGASPDWLKAKIEKSGLRSVNNIVDVTNYVLLEMGHP 264
>APLP2_HUMAN (Q06481) Amyloid-like protein 2 precursor (Amyloid protein homolog)| (APPH) (CDEI box-binding protein) (CDEBP) Length = 763 Score = 30.0 bits (66), Expect = 5.7 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 499 FDYDDSGLPLCQVMVPRPSSPTGCVDAVFITEAD 398 F+ +D + +C+ M+P PT VD F T AD Sbjct: 350 FESEDYCMAVCKAMIPPTPLPTNDVDVYFETSAD 383
>NPC1_CAEEL (Q19127) Niemann-Pick C1 protein homolog 1 precursor| Length = 1383 Score = 29.3 bits (64), Expect = 9.7 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -3 Query: 577 STNRNCYLEGTKASIPDRDIEDCTMEFDYDDSGLPLCQVMVPRPS 443 STNRN K+++ D+ C M+FDY + P +M RPS Sbjct: 989 STNRN------KSALDDKACRTC-MDFDYVANSYPKSSIMYHRPS 1026
>HIS81_PSEPF (Q3KHZ1) Histidinol-phosphate aminotransferase 1 (EC 2.6.1.9)| (Imidazole acetol-phosphate transaminase 1) Length = 350 Score = 29.3 bits (64), Expect = 9.7 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Frame = -3 Query: 514 DCTMEFDYDDSGLPLCQVMVPRPSSPTGCVDAVFITEADLEGY--------DAYIDTG 365 D + D P ++ P P++PTGC+ A+ E L+G +AYID G Sbjct: 131 DAQFRINPADYAKPNGGIIFPNPNAPTGCLLALEAVEQILKGSPDSVVVVDEAYIDFG 188
>FMT_GLUOX (Q5FPX2) Methionyl-tRNA formyltransferase (EC 2.1.2.9)| Length = 304 Score = 29.3 bits (64), Expect = 9.7 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 97 LGCRNLHVSTMPDWLTACLSTNGVSCISDSQHGENWVKLVSGL 225 LGC N+H S +P W A + + DSQ G + +++ GL Sbjct: 102 LGCLNIHASLLPRWRGASPIQSAI-VAGDSQSGVSIMQMDEGL 143 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,450,048 Number of Sequences: 219361 Number of extensions: 2023627 Number of successful extensions: 4556 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4554 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)