| Clone Name | rbaal37b17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | METX_CHRVO (Q7NZY3) Homoserine O-acetyltransferase (EC 2.3.1.31)... | 33 | 0.63 | 2 | SAT1_MESAU (Q01612) Diamine acetyltransferase 1 (EC 2.3.1.57) (S... | 30 | 5.3 | 3 | OFUT1_CAEEL (Q18014) Putative GDP-fucose protein O-fucosyltransf... | 30 | 5.3 | 4 | METX_ACIAD (Q6FEQ3) Homoserine O-acetyltransferase (EC 2.3.1.31)... | 30 | 5.3 | 5 | CAPSD_PCV2 (O56129) Capsid protein | 30 | 6.9 |
|---|
>METX_CHRVO (Q7NZY3) Homoserine O-acetyltransferase (EC 2.3.1.31) (Homoserine| O-trans-acetylase) (Homoserine transacetylase) (HTA) Length = 380 Score = 33.5 bits (75), Expect = 0.63 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 576 DQGACLVLCHLASGHSTARGHTRGDDKTIG 665 D+ +++CH SGH G+ R DDKT G Sbjct: 46 DKSNAILICHALSGHHHVAGYYRADDKTPG 75
>SAT1_MESAU (Q01612) Diamine acetyltransferase 1 (EC 2.3.1.57)| (Spermidine/spermine N(1)-acetyltransferase 1) (SSAT) (SSAT-1) (Putrescine acetyltransferase) (Polyamine N-acetyltransferase 1) Length = 171 Score = 30.4 bits (67), Expect = 5.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 30 HFTXPKWXQPSLHVIHRRVVSSLYKNKTWRV 122 HF +W +PS++ RR S L + WR+ Sbjct: 126 HFLVAEWNEPSINFYKRRAASDLSSEEGWRL 156
>OFUT1_CAEEL (Q18014) Putative GDP-fucose protein O-fucosyltransferase 1| precursor (EC 2.4.1.221) (Peptide-O-fucosyltransferase) (O-FucT-1) Length = 389 Score = 30.4 bits (67), Expect = 5.3 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +3 Query: 273 PPPDHQIASWSGSPCPAPSIKSIYSNHQR*EKKFLKWSSSAR*DHKVLLAAYAATP 440 P ++ + ++S +P P PS ++S +K+L+WSS K ++A A P Sbjct: 183 PSEEYPVLAFSSAPAPFPSKGKVWSI-----QKYLRWSSRITEQAKKFISANLAKP 233
>METX_ACIAD (Q6FEQ3) Homoserine O-acetyltransferase (EC 2.3.1.31) (Homoserine| O-trans-acetylase) (Homoserine transacetylase) (HTA) Length = 387 Score = 30.4 bits (67), Expect = 5.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 576 DQGACLVLCHLASGHSTARGHTRGDDKTIG 665 D +++CH SGH A G+ DDK G Sbjct: 46 DYSNAILICHALSGHHHAAGYHHDDDKKAG 75
>CAPSD_PCV2 (O56129) Capsid protein| Length = 233 Score = 30.0 bits (66), Expect = 6.9 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 Query: 635 THERRRQNDRRHAPRTHLG 691 T+ RRR RRH PR+HLG Sbjct: 2 TYPRRRYRRRRHRPRSHLG 20 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 104,553,325 Number of Sequences: 219361 Number of extensions: 2252146 Number of successful extensions: 6078 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6064 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6856295237 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)