| Clone Name | rbaal37b12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NADAP_HUMAN (Q9BWU0) Kanadaptin (Kidney anion exchanger adapter ... | 45 | 2e-04 | 2 | KRA51_HUMAN (Q6L8H4) Keratin-associated protein 5-1 (Keratin-ass... | 32 | 1.1 | 3 | YL688_MIMIV (Q5UNV2) Hypothetical protein L688 | 30 | 5.6 | 4 | KUP_CORGL (Q8NSG3) Probable potassium transport system protein kup | 30 | 7.3 | 5 | RCOR2_RAT (Q5FWT8) REST corepressor 2 | 29 | 9.6 | 6 | RCOR2_MOUSE (Q8C796) REST corepressor 2 (M-CoREST) | 29 | 9.6 | 7 | RCOR2_HUMAN (Q8IZ40) REST corepressor 2 | 29 | 9.6 |
|---|
>NADAP_HUMAN (Q9BWU0) Kanadaptin (Kidney anion exchanger adapter protein)| (Solute carrier family 4 anion exchanger member 1 adapter protein) (Lung cancer oncogene 3 protein) Length = 796 Score = 44.7 bits (104), Expect = 2e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -2 Query: 489 EAGPVHETWVPPQGQTGDGRTSLNDRLGY 403 E P + WVPP+GQ+GDGRT LND+ GY Sbjct: 768 EDDPDYCVWVPPEGQSGDGRTHLNDKYGY 796
>KRA51_HUMAN (Q6L8H4) Keratin-associated protein 5-1 (Keratin-associated protein| 5.1) (Ultrahigh sulfur keratin-associated protein 5.1) Length = 278 Score = 32.3 bits (72), Expect = 1.1 Identities = 40/113 (35%), Positives = 43/113 (38%), Gaps = 9/113 (7%) Frame = -1 Query: 340 LCCCSWIVNMCSESSDGIKPLGV-----GACGILGRHWSRG*LT*IGN--GGYWSLGQSF 182 +CCC V CS SS G G GACG G S+G G GG S G S Sbjct: 140 MCCC---VPACSCSSCGKGGCGSCGCSKGACGSCGG--SKGGCGSCGGCKGGCGSCGGSK 194 Query: 181 KGT*IQSSG*AFRTYVCRY*DCRRECIS--PCQGFRNGCISSCLITRFCKVLC 29 G SG C C C S C G + GC SSC CK C Sbjct: 195 GGC---GSGCGGCGSGCGVPVCCCSCSSCGSCAGSKGGCGSSCSQCSCCKPCC 244
>YL688_MIMIV (Q5UNV2) Hypothetical protein L688| Length = 236 Score = 30.0 bits (66), Expect = 5.6 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -1 Query: 142 TYVC-RY*DCRRECISPCQGFRNGCISSCLITRFCKVLC 29 TY C Y +C C SPC + C+ C ++ C C Sbjct: 27 TYPCVTYGNCYTTCASPCLPYPTNCVQVCTSSQPCPSPC 65
>KUP_CORGL (Q8NSG3) Probable potassium transport system protein kup| Length = 624 Score = 29.6 bits (65), Expect = 7.3 Identities = 13/30 (43%), Positives = 22/30 (73%), Gaps = 2/30 (6%) Frame = -2 Query: 132 VVIKIVEENVYH--PVKVSEMDVYHHVSLR 49 V+++IV+E+V H P + +EM+V HH +R Sbjct: 510 VIVRIVQEHVPHVPPEERAEMEVLHHAPIR 539
>RCOR2_RAT (Q5FWT8) REST corepressor 2| Length = 523 Score = 29.3 bits (64), Expect = 9.6 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 174 VPLKL*PSDQ*PPLPI*VSQPLLQCRPSIPQAPT 275 VP + P+ PP P +SQP RP +P APT Sbjct: 429 VPRSVPPAPPPPPPPTSLSQPPPLLRPPLPTAPT 462
>RCOR2_MOUSE (Q8C796) REST corepressor 2 (M-CoREST)| Length = 523 Score = 29.3 bits (64), Expect = 9.6 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 174 VPLKL*PSDQ*PPLPI*VSQPLLQCRPSIPQAPT 275 VP + P+ PP P +SQP RP +P APT Sbjct: 429 VPRSVPPAPPPPPPPTSLSQPPPLLRPPLPTAPT 462
>RCOR2_HUMAN (Q8IZ40) REST corepressor 2| Length = 523 Score = 29.3 bits (64), Expect = 9.6 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 174 VPLKL*PSDQ*PPLPI*VSQPLLQCRPSIPQAPT 275 VP + P+ PP P +SQP RP +P APT Sbjct: 429 VPRSVPPAPPPPPPPTSLSQPPPLLRPPLPTAPT 462 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,788,768 Number of Sequences: 219361 Number of extensions: 2004539 Number of successful extensions: 5659 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 5373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5643 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)