| Clone Name | rbaal37a23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y939_HAEIN (P44080) Hypothetical protein HI0939 | 32 | 2.1 | 2 | SCXE_ANDAU (Q9BLM2) Probable neurotoxin pcD-1008 precursor | 30 | 6.2 | 3 | MQO_BLOFL (Q7VRS0) Probable malate:quinone oxidoreductase (EC 1.... | 30 | 8.1 |
|---|
>Y939_HAEIN (P44080) Hypothetical protein HI0939| Length = 238 Score = 31.6 bits (70), Expect = 2.1 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 626 DCSRGGCHGTASSKTCESKGKNVCSS 549 D ++ GC G S KTC KGKN S Sbjct: 111 DLNKNGCIGKGSPKTCMKKGKNTSKS 136
>SCXE_ANDAU (Q9BLM2) Probable neurotoxin pcD-1008 precursor| Length = 72 Score = 30.0 bits (66), Expect = 6.2 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -3 Query: 641 VPAKTDCSRGGCHGTASSKTCE--SKGKNVC 555 +P+ C RG H A+S TC+ SKG NVC Sbjct: 36 MPSSEVCDRGCKHNGATSGTCKEFSKGGNVC 66
>MQO_BLOFL (Q7VRS0) Probable malate:quinone oxidoreductase (EC 1.1.99.16)| (Malate dehydrogenase [acceptor]) (MQO) Length = 524 Score = 29.6 bits (65), Expect = 8.1 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -3 Query: 257 VSV*MDKLLLLSSPCWILHLFKEFEKPQREIRSYYQCAPT 138 +SV + L + P WI+H+++ KP +E + + A T Sbjct: 31 MSVTLGSFLTILEPSWIIHIYERLNKPAQESSNSWNNAGT 70 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,984,300 Number of Sequences: 219361 Number of extensions: 1542710 Number of successful extensions: 3425 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3310 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3422 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)