| Clone Name | rbaal36j02 |
|---|---|
| Clone Library Name | barley_pub |
>P73L_RAT (Q9JJP6) Tumor protein p73-like (p73L) (p63)| (Transformation-related protein 63) (TP63) (Keratinocyte transcription factor KET) Length = 680 Score = 30.0 bits (66), Expect = 3.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 285 VPPGMVLPAVYLCTPPAPYP 344 +PP + +P+ CTPP PYP Sbjct: 525 LPPPLSMPSTSHCTPPPPYP 544
>P73L_MOUSE (O88898) Tumor protein p73-like (p73L) (p63)| (Transformation-related protein 63) Length = 680 Score = 30.0 bits (66), Expect = 3.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 285 VPPGMVLPAVYLCTPPAPYP 344 +PP + +P+ CTPP PYP Sbjct: 525 LPPPLSMPSTSHCTPPPPYP 544
>P73L_HUMAN (Q9H3D4) Tumor protein p73-like (p73L) (p63) (Tumor protein 63)| (TP63) (p51) (p40) (Keratinocyte transcription factor KET) (Chronic ulcerative stomatitis protein) (CUSP) Length = 680 Score = 30.0 bits (66), Expect = 3.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 285 VPPGMVLPAVYLCTPPAPYP 344 +PP + +P+ CTPP PYP Sbjct: 525 LPPPLSMPSTSHCTPPPPYP 544
>ROA3_RAT (Q6URK4) Heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3)| Length = 379 Score = 29.3 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -1 Query: 346 GGYGAGGVHKYTAGSTMPGGTQYYSAYERRQQLGGGSH 233 GGYG GG G GG Y Y GGG++ Sbjct: 287 GGYGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNY 324
>ROA3_MOUSE (Q8BG05) Heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3)| Length = 379 Score = 29.3 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -1 Query: 346 GGYGAGGVHKYTAGSTMPGGTQYYSAYERRQQLGGGSH 233 GGYG GG G GG Y Y GGG++ Sbjct: 287 GGYGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNY 324
>GAGD2_HUMAN (Q9HD64) G antigen family D 2 protein (XAGE-1 protein)| Length = 160 Score = 28.9 bits (63), Expect = 7.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 82 LQVGLYHAGSRRWAGRQELSSSCGSW 159 L+VG+ H GSR+ R +L S C +W Sbjct: 90 LKVGILHLGSRQKKIRIQLRSQCATW 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,669,170 Number of Sequences: 219361 Number of extensions: 894961 Number of successful extensions: 2285 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2281 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)