| Clone Name | rbaal36i14 |
|---|---|
| Clone Library Name | barley_pub |
>PURA_DROME (Q9Y0Y2) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 447 Score = 32.7 bits (73), Expect = 0.70 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -1 Query: 218 IEDRVEPCIVIHKHVQGIQEAEKGKQEIKKRCKGL 114 I DR H+HV G+QEAEKG + + KG+ Sbjct: 123 ISDRAHLVFDFHQHVDGMQEAEKGGKSLGTTKKGI 157
>Y4849_ARATH (P16128) Hypothetical protein At4g18490| Length = 594 Score = 32.3 bits (72), Expect = 0.92 Identities = 21/80 (26%), Positives = 40/80 (50%) Frame = -2 Query: 487 NLNATQNPVQLSSSNPLEAYKDLSMGRELSKPTHKLSHTLKCKRKRRSKEFVALSPDVLE 308 N+ ++ NP +SS+ +KD S G+ + ++ H LK + K ++E L ++ Sbjct: 344 NIGSSLNPTNDTSSHEKIIHKDHSNGKTVENVAGQMDH-LKLQAKNTTREKSILQINISS 402 Query: 307 KADCTVGEDELREKLQSHFA 248 K D + L +KL +H + Sbjct: 403 KLDAS----SLTQKLSNHLS 418
>PRKDC_MOUSE (P97313) DNA-dependent protein kinase catalytic subunit (EC 2.7.11.1)| (DNA-PK catalytic subunit) (DNA-PKcs) (P460) Length = 4128 Score = 32.3 bits (72), Expect = 0.92 Identities = 29/106 (27%), Positives = 54/106 (50%), Gaps = 14/106 (13%) Frame = -2 Query: 523 LVEWLQNVLSMANL---NATQNPVQLSSSN---PLEAYKDLSMGRELSKPTHKLSHTLKC 362 L+EW++N +++ +L N +Q ++S+ P+ YKD M ++S + ++ L Sbjct: 3802 LIEWIENTMTLKDLLLSNMSQEEKVANNSDPKAPIRDYKDWLM--KVSGKSDAGAYVLMY 3859 Query: 361 KRKRRSKEFVA-------LSPDVLEKADCTVG-EDELREKLQSHFA 248 R R++ VA + PD+L++A + E L+SHFA Sbjct: 3860 SRANRTETVVAFRRRESQVPPDLLKRAFVKMSTSPEAFLALRSHFA 3905
>AKL1_YEAST (P38080) Serine/threonine-protein kinase AKL1 (EC 2.7.11.1)| Length = 1108 Score = 31.2 bits (69), Expect = 2.0 Identities = 19/37 (51%), Positives = 24/37 (64%), Gaps = 3/37 (8%) Frame = +3 Query: 204 NSVLNLSFSEMPLS---TAK*LCNFSLSSSSPTVQSA 305 N VLNLS +EM LS T + +FS SSSS ++Q A Sbjct: 840 NGVLNLSLNEMDLSRDDTGAAVSSFSSSSSSASIQQA 876
>ENGA_PSESM (Q886Y6) GTP-binding protein engA| Length = 489 Score = 30.8 bits (68), Expect = 2.7 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 3/66 (4%) Frame = -2 Query: 529 KLLVEWLQNVLSMANLNATQNPVQLS---SSNPLEAYKDLSMGRELSKPTHKLSHTLKCK 359 K V +L+N L P+++ NP E K+ R+++K +SH K Sbjct: 424 KSYVRYLENTYRRV-LKLVGTPIRIEFKGGENPYEGNKNTLTDRQVNKKRRMMSHHKKAD 482 Query: 358 RKRRSK 341 +KRR K Sbjct: 483 KKRRDK 488
>PZRN3_RAT (P68907) PDZ domain-containing RING finger protein 3 (Semaphorin| cytoplasmic domain-associated protein 3) (SEMACAP3 protein) Length = 1062 Score = 30.0 bits (66), Expect = 4.5 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -2 Query: 436 EAYKDLSMGRELSKPTHKLSHTLKCKRKRRSKEFVALSP-DVLEKADCTVGEDELREKLQ 260 +A ++ MGR SK K H +K K +RR +EF+ S D L++ + E+ Sbjct: 958 DAMSEMKMGRYWSKEERK-QHLVKAKEQRRRREFMMQSRLDCLKEQQASDDRKEMNILEL 1016 Query: 259 SHFAVLR 239 SH +++ Sbjct: 1017 SHKKMMK 1023
>PZRN3_MOUSE (Q69ZS0) PDZ domain-containing RING finger protein 3 (Semaphorin| cytoplasmic domain-associated protein 3) (SEMACAP3 protein) Length = 1063 Score = 30.0 bits (66), Expect = 4.5 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -2 Query: 436 EAYKDLSMGRELSKPTHKLSHTLKCKRKRRSKEFVALSP-DVLEKADCTVGEDELREKLQ 260 +A ++ MGR SK K H +K K +RR +EF+ S D L++ + E+ Sbjct: 959 DAMSEMKMGRYWSKEERK-QHLVKAKEQRRRREFMMQSRLDCLKEQQASDDRKEMNILEL 1017 Query: 259 SHFAVLR 239 SH +++ Sbjct: 1018 SHKKMMK 1024
>CG146_HUMAN (Q9BSY9) UPF0326 protein CGI-146| Length = 194 Score = 30.0 bits (66), Expect = 4.5 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +1 Query: 130 FLISCLPFSASCIPCTCLWMTMHGSTRSSISHSQKCLLVQQNDFATSLSV 279 + SC+PF SC+P W+T + +SS+S + L + D A S SV Sbjct: 133 YFSSCIPFLQSCLPKE--WLT-PAALQSSVSQELQDELEEAEDAAASASV 179
>PZRN3_HUMAN (Q9UPQ7) PDZ domain-containing RING finger protein 3 (Ligand of| Numb-protein X 3) (Semaphorin cytoplasmic domain-associated protein 3) (SEMACAP3 protein) Length = 1066 Score = 29.6 bits (65), Expect = 5.9 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = -2 Query: 436 EAYKDLSMGRELSKPTHKLSHTLKCKRKRRSKEFVALSP-DVLEKADCTVGEDELREKLQ 260 +A ++ MGR SK K H +K K +RR +EF+ S D L++ E+ Sbjct: 962 DAVSEMKMGRYWSKEERK-QHLVKAKEQRRRREFMMQSRLDCLKEQQAADDRKEMNILEL 1020 Query: 259 SHFAVLR 239 SH +++ Sbjct: 1021 SHKKMMK 1027
>K0555_HUMAN (Q96AA8) Protein KIAA0555| Length = 810 Score = 29.6 bits (65), Expect = 5.9 Identities = 28/88 (31%), Positives = 37/88 (42%), Gaps = 3/88 (3%) Frame = -2 Query: 508 QNVLSMANLNATQNPVQLSSSNPL---EAYKDLSMGRELSKPTHKLSHTLKCKRKRRSKE 338 +N +A LNAT +L N L E + L RE K L KC KR + Sbjct: 283 RNQKRIAELNATIR--KLEDRNTLLGDERNELLKRVRETEKQCKPLLERNKCLAKRNDEL 340 Query: 337 FVALSPDVLEKADCTVGEDELREKLQSH 254 V+L + T E+REK+ SH Sbjct: 341 MVSLQRMEEKLKAVTKENSEMREKITSH 368
>ENGA_PSEPK (Q88PJ3) GTP-binding protein engA| Length = 487 Score = 29.3 bits (64), Expect = 7.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 445 NPLEAYKDLSMGRELSKPTHKLSHTLKCKRKRRSK 341 NP E K+ R+++K +SH K ++KRR K Sbjct: 452 NPYEGKKNTLTDRQVNKKRRLMSHHKKAEKKRRDK 486
>EF2_SULAC (P23112) Elongation factor 2 (EF-2)| Length = 736 Score = 29.3 bits (64), Expect = 7.8 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -1 Query: 218 IEDRVEPCIVIHKHVQGIQEAEKGKQEIKKRCKGLVV 108 +E+RV P + I+K + I+E + QEI+KR L++ Sbjct: 135 LEERVRPILFINKVDRLIKELKLSSQEIQKRLIDLII 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,924,620 Number of Sequences: 219361 Number of extensions: 1533845 Number of successful extensions: 4771 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 4624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4769 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)