| Clone Name | rbaal36f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OTX1L_BRARE (Q90267) Homeobox protein Otx1l (ZOTX3) | 29 | 5.5 | 2 | ESL2_MYCGE (Q49418) Putative esterase/lipase 2 (EC 3.1.-.-) | 28 | 9.4 |
|---|
>OTX1L_BRARE (Q90267) Homeobox protein Otx1l (ZOTX3)| Length = 338 Score = 29.3 bits (64), Expect = 5.5 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +2 Query: 248 CRLTTVELA*NSWIRAALAGPTHGSRSPHNSSSGHVSFPSSLSS 379 CR + + NS IR A P+ SP + SSGH + P+ SS Sbjct: 93 CRQQQQQSSTNSKIRPAKKKPSPSRESPGSESSGHFTPPAVSSS 136
>ESL2_MYCGE (Q49418) Putative esterase/lipase 2 (EC 3.1.-.-)| Length = 268 Score = 28.5 bits (62), Expect = 9.4 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -2 Query: 243 GHCPHDEAPEQFNAALLQWLASLEEE 166 GH PHD AP+ F +L++L +L+++ Sbjct: 241 GHSPHDSAPKLFFDYVLEFLDNLKKQ 266 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,973,253 Number of Sequences: 219361 Number of extensions: 575057 Number of successful extensions: 2177 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2177 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)