| Clone Name | rbaal35n16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NECD_MOUSE (P25233) Necdin | 33 | 1.0 | 2 | TESK2_MOUSE (Q8VCT9) Dual specificity testis-specific protein ki... | 31 | 4.0 | 3 | IPO11_MOUSE (Q8K2V6) Importin-11 (Imp11) (Ran-binding protein 11... | 30 | 5.2 | 4 | PANB_RHOPA (Q6N583) 3-methyl-2-oxobutanoate hydroxymethyltransfe... | 30 | 5.2 | 5 | TRI56_MOUSE (Q80VI1) Tripartite motif protein 56 | 30 | 8.8 |
|---|
>NECD_MOUSE (P25233) Necdin| Length = 325 Score = 32.7 bits (73), Expect = 1.0 Identities = 18/44 (40%), Positives = 25/44 (56%) Frame = +1 Query: 55 DRQRIGIPTKPPAFILQHLQQPPVPCSLQGPSRKQRAFPGPDHR 186 D +GIP PPA + +L PP C+ +GP Q+A P P+ R Sbjct: 26 DAVPVGIP--PPASLAANLAGPP--CAPEGPMAAQQASPPPEER 65
>TESK2_MOUSE (Q8VCT9) Dual specificity testis-specific protein kinase 2 (EC| 2.7.12.1) (Testicular protein kinase 2) Length = 570 Score = 30.8 bits (68), Expect = 4.0 Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 2/99 (2%) Frame = +1 Query: 85 PPAFILQHLQQPPVPCSLQGPSRKQRAFPG-PDHRQSLCASKT*EYTGAKEYVEQAPPRV 261 P + L Q+P L SR+ R+ PG P+ C + G +E + PP Sbjct: 435 PGSTTLADCQEP-----LAMSSRRWRSLPGSPEFLHQACP-----FMGCEESLSDGPPPR 484 Query: 262 HS*IRHG-EEDPRFRHSTLHLLYGTNPLAGSSPLPMIGF 375 S +++G E P FR S L G + S+P GF Sbjct: 485 LSSLKYGVREIPPFRTSALSAASGHEAMDCSNPQEENGF 523
>IPO11_MOUSE (Q8K2V6) Importin-11 (Imp11) (Ran-binding protein 11) (RanBP11)| Length = 975 Score = 30.4 bits (67), Expect = 5.2 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = -2 Query: 253 EEPVPHIPLLRCILRF---YSHTEIGGGLAQEMHVVSCLGLV 137 + P+ PL++ L F Y TE+G G+ E +V C+ L+ Sbjct: 283 QHPISFTPLIQRSLEFSVSYVFTEVGEGVTFERFIVQCMNLI 324
>PANB_RHOPA (Q6N583) 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC| 2.1.2.11) (Ketopantoate hydroxymethyltransferase) Length = 274 Score = 30.4 bits (67), Expect = 5.2 Identities = 14/42 (33%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = +1 Query: 67 IGIPTKPPAFILQHLQQPP-VPCSLQGPSR--KQRAFPGPDH 183 +G+ KPP F+ ++ P + +++G + + RAFPGP+H Sbjct: 225 LGLSPKPPKFVKRYGDLGPGIEAAIKGYAEEVRSRAFPGPEH 266
>TRI56_MOUSE (Q80VI1) Tripartite motif protein 56| Length = 734 Score = 29.6 bits (65), Expect = 8.8 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -1 Query: 173 PGNARCFLLGPCNEQGTGGCCKCCRIKAGGFVGMPILCLSHVV 45 PG A CFL PC++ CK CR+ G + P L L+ V Sbjct: 173 PGEALCFLCQPCSQL----LCKDCRL--GPHIDHPCLPLAEAV 209 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,905,684 Number of Sequences: 219361 Number of extensions: 2054432 Number of successful extensions: 5240 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5015 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5237 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6655306086 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)