| Clone Name | rbaal35n03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RISB_BDEBA (P61720) 6,7-dimethyl-8-ribityllumazine synthase (EC ... | 32 | 1.4 | 2 | OAF_DROME (Q9NLA6) Out at first protein [Contains: Out at first ... | 31 | 1.9 | 3 | AL1B2_BOVIN (P52476) Aldehyde dehydrogenase X, mitochondrial (EC... | 29 | 7.2 | 4 | NIP29_YEAST (P33419) Protein NIP29 | 29 | 7.2 | 5 | LVA_DROME (Q8MSS1) Protein lava lamp | 29 | 9.3 |
|---|
>RISB_BDEBA (P61720) 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.9) (DMRL| synthase) (Lumazine synthase) (Riboflavin synthase beta chain) Length = 179 Score = 31.6 bits (70), Expect = 1.4 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -1 Query: 198 RIGGDHGSSNESQAQWTVQMIQASEQI 118 R GGDHG+ E AQ T++MI +++I Sbjct: 115 RAGGDHGNKGEEAAQVTMEMIGLTQEI 141
>OAF_DROME (Q9NLA6) Out at first protein [Contains: Out at first short| protein] Length = 487 Score = 31.2 bits (69), Expect = 1.9 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = -2 Query: 437 IRKAHILIHQDHKVAVSEAQSQSHSQV--PLNHQRKEASMHAPFTWCNPPGSKGS 279 I ++H HK + + Q Q HSQV +HQ ++ P T +PP S S Sbjct: 422 ISQSHHQSQSQHKPSRQQKQHQHHSQVAPTSHHQSSSSTPPTPSTSSSPPSSSSS 476
>AL1B2_BOVIN (P52476) Aldehyde dehydrogenase X, mitochondrial (EC 1.2.1.3)| (ALDHX) (ALDH class 2) (Fragment) Length = 126 Score = 29.3 bits (64), Expect = 7.2 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -3 Query: 226 KQSFNLSFLKNRR*PRKQQRVSSPVDCTNDPGFRADRKLDERIIG 92 ++S FL+ KQ+RV +P D G + DR+ ERI+G Sbjct: 39 EESIYDEFLERTVEKAKQRRVGNPFDLDTQQGPQVDRERFERILG 83
>NIP29_YEAST (P33419) Protein NIP29| Length = 253 Score = 29.3 bits (64), Expect = 7.2 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = -3 Query: 247 KALSHLHKQSF--NLSFLKNRR*PRKQQRVSSPVDCTNDPGFRADRKL 110 +AL L +++F N S L N++ R Q+R+SSP+ + G DRK+ Sbjct: 28 EALKKLREENFSSNTSELGNKKHYRAQERMSSPLHRLSPTGKSDDRKV 75
>LVA_DROME (Q8MSS1) Protein lava lamp| Length = 2779 Score = 28.9 bits (63), Expect = 9.3 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -1 Query: 135 QASEQIEN*MSES*DLGSSKTFLVIEELLIPKKPVLQCSRLELQ 4 QA E + + +S DLG +T V+E L+ PKK L + E+Q Sbjct: 1877 QAEETVPDAVSHHLDLGLPQTEPVVEPLIQPKKAYLCQPKQEIQ 1920 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,763,337 Number of Sequences: 219361 Number of extensions: 1234104 Number of successful extensions: 2786 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2785 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)