| Clone Name | rbaal35n02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATKA_PSEPK (Q88FD7) Potassium-transporting ATPase A chain (EC 3.... | 31 | 3.8 | 2 | Y396_HELPJ (Q9ZKF3) Hypothetical protein jhp_0985 | 30 | 5.0 | 3 | PA2GX_HUMAN (O15496) Group 10 secretory phospholipase A2 precurs... | 30 | 8.6 |
|---|
>ATKA_PSEPK (Q88FD7) Potassium-transporting ATPase A chain (EC 3.6.3.12)| (Potassium-translocating ATPase A chain) (ATP phosphohydrolase [potassium-transporting] A chain) (Potassium-binding and translocating subunit A) Length = 564 Score = 30.8 bits (68), Expect = 3.8 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 5/55 (9%) Frame = -3 Query: 505 TAAAMVWDIYT--AEDKLEAAVRDSVNALT---AVVNLEVGEIVTTAVEAGFVAL 356 T +++W + T A + A+ DS+N LT A+VN+ VGE++ V AG + Sbjct: 333 TTGSVLWAVTTTAASNGSVNAMHDSLNPLTGMVAMVNMMVGEVIFGGVGAGLYGM 387
>Y396_HELPJ (Q9ZKF3) Hypothetical protein jhp_0985| Length = 616 Score = 30.4 bits (67), Expect = 5.0 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -1 Query: 591 LLRKRDKE-NLW*LTHLKLWEKSG 523 L+ K+DKE NLW L LK WEK G Sbjct: 129 LITKQDKEVNLWDLPVLKTWEKDG 152
>PA2GX_HUMAN (O15496) Group 10 secretory phospholipase A2 precursor (EC 3.1.1.4)| (Group X secretory phospholipase A2) (Phosphatidylcholine 2-acylhydrolase GX) (GX sPLA2) (sPLA2-X) Length = 155 Score = 29.6 bits (65), Expect = 8.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 344 CFCGCHGNWRSRRFWNWCAHWDSC 273 CFCG G+ + R +WC H C Sbjct: 57 CFCGLGGHGQPRDAIDWCCHGHDC 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,246,743 Number of Sequences: 219361 Number of extensions: 1054809 Number of successful extensions: 2711 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2674 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2710 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6484657212 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)