| Clone Name | rbaal36b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYS_ARATH (Q39230) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--... | 33 | 0.42 | 2 | SYSC_SCHPO (O14018) Seryl-tRNA synthetase, cytoplasmic (EC 6.1.1... | 30 | 4.6 | 3 | COR1A_HUMAN (P31146) Coronin-1A (Coronin-like protein p57) (Coro... | 30 | 6.1 | 4 | COR2B_HUMAN (Q9UQ03) Coronin-2B (Coronin-like protein C) (Clipin... | 29 | 7.9 |
|---|
>SYS_ARATH (Q39230) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 451 Score = 33.5 bits (75), Expect = 0.42 Identities = 19/34 (55%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -3 Query: 558 KALQPFMGGIDFLPFK-RPLDSKQAADSKPNKSK 460 + LQPFMGG FLPFK +P+ AD+K KSK Sbjct: 421 EVLQPFMGGETFLPFKAKPV----VADTKGKKSK 450
>SYSC_SCHPO (O14018) Seryl-tRNA synthetase, cytoplasmic (EC 6.1.1.11)| (Serine--tRNA ligase) (SerRS) Length = 450 Score = 30.0 bits (66), Expect = 4.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 558 KALQPFMGGIDFLPFKRPLDSKQAADSKPN 469 K LQP+MGG FLPF + L + N Sbjct: 421 KVLQPYMGGKTFLPFTKELPKNSTSKKGKN 450
>COR1A_HUMAN (P31146) Coronin-1A (Coronin-like protein p57) (Coronin-like| protein A) (CLIPINA) (Tryptophan aspartate-containing coat protein) (TACO) Length = 461 Score = 29.6 bits (65), Expect = 6.1 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -2 Query: 160 WHNPASGL---IRDSTEDLHGRAVRIGFPFWLFCLQNIAIQAACSH 32 W P GL +R+ L G R+G W QN+ + A C + Sbjct: 109 WEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDN 154
>COR2B_HUMAN (Q9UQ03) Coronin-2B (Coronin-like protein C) (ClipinC) (Protein| FC96) Length = 475 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -2 Query: 160 WHNPASGLIRDSTE---DLHGRAVRIGFPFWLFCLQNIAIQA 44 W P GL R+ TE +LHG + R+G W NI A Sbjct: 110 WEIPEGGLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSA 151 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,964,846 Number of Sequences: 219361 Number of extensions: 1800148 Number of successful extensions: 3967 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3967 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)