ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal35m01 |
|---|---|
| Clone Library Name | barley_pub |
>SRCH_RABIT (P16230) Sarcoplasmic reticulum histidine-rich calcium-binding| protein precursor Length = 852 Score = 32.0 bits (71), Expect = 1.6 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +2 Query: 389 HRTEHASHDHPTNEGHQKRRPPEVPTHHYVRGG---YECHRGAYRSQPHQ 529 H H H + EGH + EVP HH R G RG S P Q Sbjct: 577 HVASHPPPGHRSREGHAEEHQTEVPGHHQHRMGDTDTSAERGHPASSPRQ 626
>CREB5_MOUSE (Q8K1L0) cAMP response element-binding protein 5 (CRE-BPa)| (Fragment) Length = 353 Score = 31.6 bits (70), Expect = 2.1 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +2 Query: 338 HLLPN*TCALGLHHIVCHRTEHASHDHPTNEGHQKRRPPEVPTHHYVRGGYECHRGAYRS 517 H P+ L HH H+ +H +H HP + H ++ P HH+ H +++ Sbjct: 120 HSHPHQHQTLPPHHPYPHQHQHPAH-HPHPQPHHQQNHP----HHHSHSHLHAHPAHHQT 174 Query: 518 QPH 526 PH Sbjct: 175 SPH 177
>CREB5_HUMAN (Q02930) cAMP response element-binding protein 5 (CRE-BPa)| Length = 508 Score = 31.6 bits (70), Expect = 2.1 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +2 Query: 338 HLLPN*TCALGLHHIVCHRTEHASHDHPTNEGHQKRRPPEVPTHHYVRGGYECHRGAYRS 517 H P+ L HH H+ +H +H HP + H ++ P HH+ H +++ Sbjct: 275 HSHPHQHQTLPPHHPYPHQHQHPAH-HPHPQPHHQQNHP----HHHSHSHLHAHPAHHQT 329 Query: 518 QPH 526 PH Sbjct: 330 SPH 332
>TRPP_CLOPE (P58725) Probable tryptophan transport protein| Length = 182 Score = 31.2 bits (69), Expect = 2.7 Identities = 19/92 (20%), Positives = 49/92 (53%), Gaps = 1/92 (1%) Frame = -3 Query: 625 ALFTSLAVVVVQITLVRGETKAERRVVEVINKLMWLASVCTTVAFISSSYIVVGRHFRWA 446 AL L + +++ + + G E+R ++ ++ L ++ + + F+ ++ I+VG ++ Sbjct: 88 ALIVFLFIALIKKSNILGRLSVEKRNNILMAIVLPLGTLVSGILFLGTAKIIVGLPASFS 147 Query: 445 ALLVT-LIGGVIMAGVLGTMTYYVVKSKRTRS 353 L +T ++ V + V+G + Y +V+ R+ Sbjct: 148 ILFLTVVVPSVALNTVIGLVLYRIVEKSLRRA 179
>PP1RA_MACMU (Q5TM61) Serine/threonine-protein phosphatase 1 regulatory subunit 10| (MHC class I region proline-rich protein CAT53) Length = 940 Score = 30.8 bits (68), Expect = 3.6 Identities = 18/58 (31%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Frame = +2 Query: 401 HASHDHPTNEGHQKRRPPEVPTHH----YVRGGYECHRGAYRSQPHQLVDNLHNSPLC 562 H HD P + GH R PP H + GG+ H G H ++ N P+C Sbjct: 860 HRPHDVPGHRGHDHRGPPHEHRGHDGPGHGGGGHRGHDGG-----HSHGGDMSNRPVC 912
>SYI_PYRAE (Q8ZWU4) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 981 Score = 30.8 bits (68), Expect = 3.6 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = +2 Query: 386 CHRTEHASHDHPTNEGHQKRRPPEVPTHHYVRGGYECHRGAYRSQPHQLVDN 541 C R E + DH G+ +R P + V GG + + + + P +VDN Sbjct: 185 CPRCETSLSDHEVALGYDEREDPSIYVKFRVEGGVDEYLVIWTTTPWTIVDN 236
>DEC11_DROME (P18169) Defective chorion-1 protein, FC125 isoform precursor| Length = 1208 Score = 30.0 bits (66), Expect = 6.1 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +3 Query: 87 IEEHQLIGMYTVKPHIPTAPGGSKLFILSAIPPFFLHPCRVAPPKRPRIYR-PERSPHMA 263 + +HQ + T+ P P GGS+ ++ PP L P P+ R+++ P +P Sbjct: 936 LRQHQTMAR-TINPKQPGEVGGSESQKSNSNPPTTLTPAPQEQPQEHRVHKSPSSAPSET 994 Query: 264 YIRSISESDSEL 299 I + SD ++ Sbjct: 995 EIENAPSSDPQV 1006
>ATG9_YARLI (Q6C2F5) Autophagy-related protein 9| Length = 788 Score = 29.6 bits (65), Expect = 7.9 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +2 Query: 398 EHASHDHPTNEGHQKRRPPEVPTHHYVRGGYECHRGAYRSQPHQL--VDNLHNS 553 EHA +N + +VPT V G + G+ R QPH++ + NL +S Sbjct: 39 EHAQTSDNSNSDNDSGNDSDVPTSLMVEGVQDPKPGSKRRQPHRMATLSNLQSS 92
>PP1RA_PANTR (Q7YR38) Serine/threonine-protein phosphatase 1 regulatory subunit 10| (MHC class I region proline-rich protein CAT53) (Protein FB19) Length = 940 Score = 29.6 bits (65), Expect = 7.9 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = +2 Query: 401 HASHDHPTNEGHQKRRPPEVPTHHYVRGGYECHRGAYRSQP--HQLVDNLHNSPLC 562 H HD P + GH R PP P H G G +R H ++ N P+C Sbjct: 859 HRPHDVPGHRGHDHRGPP--PHEHRGHDGPGHGGGGHRGHDGGHSHGGDMSNRPVC 912
>PP1RA_HUMAN (Q96QC0) Serine/threonine-protein phosphatase 1 regulatory subunit 10| (Phosphatase 1 nuclear targeting subunit) (MHC class I region proline-rich protein CAT53) (FB19 protein) (PP1-binding protein of 114 kDa) (p99) Length = 940 Score = 29.6 bits (65), Expect = 7.9 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = +2 Query: 401 HASHDHPTNEGHQKRRPPEVPTHHYVRGGYECHRGAYRSQP--HQLVDNLHNSPLC 562 H HD P + GH R PP P H G G +R H ++ N P+C Sbjct: 859 HRPHDVPGHRGHDHRGPP--PHEHRGHDGPGHGGGGHRGHDGGHSHGGDMSNRPVC 912
>MQO_HAEDU (Q7VPC3) Probable malate:quinone oxidoreductase (EC 1.1.99.16)| (Malate dehydrogenase [acceptor]) (MQO) Length = 489 Score = 29.6 bits (65), Expect = 7.9 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = -3 Query: 436 VTLIGGVIMAGVLGTMTYYVVKSKRTRSIRKKVKSTRRSGSNSWNHNSESDSEI 275 +TLIG IM+ LGT+ +V K + +I +++ SN WN+ S + Sbjct: 12 ITLIGAGIMSATLGTLLAELVPHK-SITIFEQLAEVALESSNEWNNAGTGHSAL 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,087,361 Number of Sequences: 219361 Number of extensions: 2366364 Number of successful extensions: 6830 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 6319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6768 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
