| Clone Name | rbaal35l19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ACHA2_PANTR (Q5IS52) Neuronal acetylcholine receptor protein, al... | 29 | 2.8 | 2 | ACHA2_HUMAN (Q15822) Neuronal acetylcholine receptor protein, al... | 29 | 2.8 | 3 | RPOC2_MAIZE (P16025) DNA-directed RNA polymerase beta'' chain (E... | 28 | 6.1 |
|---|
>ACHA2_PANTR (Q5IS52) Neuronal acetylcholine receptor protein, alpha-2 subunit| precursor Length = 529 Score = 29.3 bits (64), Expect = 2.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 146 CAGHTVPSILTMCIHVSMCDAAHGRIAYA 60 CAGH PS+ T+C H + A G A A Sbjct: 425 CAGHVAPSVGTLCSHGHLHSGASGPKAEA 453
>ACHA2_HUMAN (Q15822) Neuronal acetylcholine receptor protein, alpha-2 subunit| precursor Length = 529 Score = 29.3 bits (64), Expect = 2.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 146 CAGHTVPSILTMCIHVSMCDAAHGRIAYA 60 CAGH PS+ T+C H + A G A A Sbjct: 425 CAGHVAPSVGTLCSHGHLHSGASGPKAEA 453
>RPOC2_MAIZE (P16025) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1527 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 265 GSGHFKVRXSRLEEDINTRTXXFHERKENFVVRADD 158 GSG K R LEE+ T+ + R+E + R +D Sbjct: 628 GSGIVKFRYRTLEEEYRTQEEEYRTREEEYRTREED 663 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,737,219 Number of Sequences: 219361 Number of extensions: 515611 Number of successful extensions: 1027 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1027 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)