| Clone Name | rbaal35i22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TTC6_HUMAN (Q86TZ1) Tetratricopeptide repeat protein 6 (TPR repe... | 31 | 1.7 | 2 | UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2 | 30 | 3.8 | 3 | UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1 | 30 | 3.8 | 4 | CD2A2_MOUSE (Q64364) Cyclin-dependent kinase inhibitor 2A, isofo... | 29 | 4.9 | 5 | SECA_TREPA (O83394) Preprotein translocase secA subunit | 28 | 8.4 |
|---|
>TTC6_HUMAN (Q86TZ1) Tetratricopeptide repeat protein 6 (TPR repeat protein 6)| Length = 520 Score = 30.8 bits (68), Expect = 1.7 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 2/83 (2%) Frame = -3 Query: 411 NHRLSPFLK--NVFDLACYHNLEAHLHLLDGYQGRGKEFKLGGRDPALVNKAADFLVDEH 238 +HR++ F + N F A L+ + LD Y GRG + G D A DFL H Sbjct: 220 HHRINEFEEAVNFFTWA----LKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALH 275 Query: 237 MVPPVWRQEFNKGLVRTEDGRWQ 169 + P + + G G++Q Sbjct: 276 INPAYIKARISFGYNLQAQGKFQ 298
>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2| Length = 1051 Score = 29.6 bits (65), Expect = 3.8 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -3 Query: 417 ALNHRLSPFLKNVFDLACYHNLEAHLHLLDGYQGR 313 AL +R SP +NVF+ A + NL+A ++ LD R Sbjct: 541 ALQNRASPETENVFNDAFWENLDAVVNALDNVTAR 575
>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1| Length = 1051 Score = 29.6 bits (65), Expect = 3.8 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -3 Query: 417 ALNHRLSPFLKNVFDLACYHNLEAHLHLLDGYQGR 313 AL +R SP +NVF+ A + NL+A ++ LD R Sbjct: 541 ALQNRASPETENVFNDAFWENLDAVVNALDNVTAR 575
>CD2A2_MOUSE (Q64364) Cyclin-dependent kinase inhibitor 2A, isoform 3 (p19ARF)| Length = 169 Score = 29.3 bits (64), Expect = 4.9 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -2 Query: 283 PGARQQGGRLPRGRAHGAARV 221 PGAR+ GRLP G A GAARV Sbjct: 94 PGARRSAGRLP-GHAGGAARV 113
>SECA_TREPA (O83394) Preprotein translocase secA subunit| Length = 916 Score = 28.5 bits (62), Expect = 8.4 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -3 Query: 318 GRGKEFKLGGRDPALVNKAADFLVDEHMVPPVWRQEFNKGLVRTEDGRWQ 169 GRG + KLGG ++A + +H V QE + E RW+ Sbjct: 515 GRGTDIKLGGNPEFRARQSATAIASKHGSSSVTVQEHMQACYEAEYTRWR 564 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,531,587 Number of Sequences: 219361 Number of extensions: 822977 Number of successful extensions: 2852 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2852 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)