| Clone Name | rbaal35i07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TOP1_ARATH (P30181) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoi... | 30 | 3.4 | 2 | SOX12_HUMAN (O15370) SOX-12 protein (SOX-22 protein) | 30 | 4.4 | 3 | YG1C_YEAST (P53211) Hypothetical 11.9 kDa protein in MSB2-UGA1 i... | 28 | 9.9 |
|---|
>TOP1_ARATH (P30181) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| Length = 916 Score = 30.0 bits (66), Expect = 3.4 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = -3 Query: 219 ASPRAANVLSPRAAEL*RCVSCCAHGASYSASSRATVTSG 100 A P+A NV+SPR+ + + + YS SS+++ +SG Sbjct: 326 AKPKARNVVSPRSRAMTKNTKKVTKDSKYSTSSKSSPSSG 365
>SOX12_HUMAN (O15370) SOX-12 protein (SOX-22 protein)| Length = 315 Score = 29.6 bits (65), Expect = 4.4 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +3 Query: 330 GAVRPTVRLSSTTRRCWRC-YSTPR 401 G RP + +TTR CW+C +S PR Sbjct: 158 GRRRPRTTMKTTTRSCWKCAWSRPR 182
>YG1C_YEAST (P53211) Hypothetical 11.9 kDa protein in MSB2-UGA1 intergenic| region Length = 109 Score = 28.5 bits (62), Expect = 9.9 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -2 Query: 145 WSILQCQLPSNCNFWSSAASCRFLYTTLI*LSAFGLCL 32 WS+ C L S +FW A FLY L+ L CL Sbjct: 66 WSLSSCLLVSEVSFWPGAG---FLYNDLVCLDREDHCL 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,771,781 Number of Sequences: 219361 Number of extensions: 1015793 Number of successful extensions: 2772 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2772 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)