| Clone Name | rbaal35f22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 pr... | 31 | 1.0 | 2 | NOTC2_RAT (Q9QW30) Neurogenic locus notch homolog protein 2 prec... | 30 | 1.8 | 3 | TEP1_HUMAN (Q99973) Telomerase protein component 1 (Telomerase-a... | 29 | 3.0 |
|---|
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 30.8 bits (68), Expect = 1.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = -2 Query: 110 HRRSAPACCCWNLKDCSMACLSYLCT---MCXSVRDP 9 H S P C C N KDC C S C C R P Sbjct: 1357 HTDSGPRCFCLNPKDCESGCASNPCQHGGTCYPQRQP 1393
>NOTC2_RAT (Q9QW30) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 30.0 bits (66), Expect = 1.8 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = -2 Query: 110 HRRSAPACCCWNLKDCSMACLSYLCT---MCXSVRDP 9 H S P C C N KDC C S C C R P Sbjct: 1359 HTASGPHCFCPNHKDCESGCASNPCQHGGTCYPQRQP 1395
>TEP1_HUMAN (Q99973) Telomerase protein component 1 (Telomerase-associated| protein 1) (Telomerase protein 1) (p240) (p80 telomerase homolog) Length = 2627 Score = 29.3 bits (64), Expect = 3.0 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = -2 Query: 179 PSYFHSIGSSKTL*GCVVLLVSGHRRSAPACCCWNLKDCSMACLSYLCTMCXS 21 PSY S+G + + V L SG S P L++ MA LS LC+ S Sbjct: 206 PSYSLSLGEEEEVEDLAVKLTSGDSESHPEPTDHVLQEKKMALLSLLCSTLVS 258 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,916,498 Number of Sequences: 219361 Number of extensions: 330673 Number of successful extensions: 715 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)