| Clone Name | rbaal7p17 |
|---|---|
| Clone Library Name | barley_pub |
>AMAA_BACST (P37112) N-acyl-L-amino acid amidohydrolase (EC 3.5.1.14)| (L-aminoacylase) Length = 370 Score = 33.1 bits (74), Expect = 0.73 Identities = 21/53 (39%), Positives = 25/53 (47%) Frame = +3 Query: 423 GPSPRNRSRRAHGPLKSEASLVRFLRTSSQ*QSAAPWPRRASCRCRCRLPLQP 581 G R RR GPL++E RFLR ++ RR CR R RLP P Sbjct: 313 GNGVRAVRRRGSGPLETEHGRRRFLRLFAKSARQLFLRRRGQCRKRHRLPAPP 365
>GP175_RAT (Q791F6) Integral membrane protein GPR175 (Transmembrane domain| protein of 40 kDa regulated in adipocytes) (TPRA40) Length = 369 Score = 32.0 bits (71), Expect = 1.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 470 IRGFFGAIPPNFFSVTVCCPMAEASELPMPLPFAVAASHPVD 595 +RGFFG+ P FS AE ++ +P P+AVA ++ Sbjct: 277 LRGFFGSEPKILFSYKCQVDEAEEPDMHLPQPYAVARREGIE 318
>GP175_MOUSE (Q99MU1) Integral membrane protein GPR175 (Transmembrane domain| protein of 40 kDa regulated in adipocytes) (TPRA40) Length = 369 Score = 32.0 bits (71), Expect = 1.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 470 IRGFFGAIPPNFFSVTVCCPMAEASELPMPLPFAVAASHPVD 595 +RGFFG+ P FS AE ++ +P P+AVA ++ Sbjct: 277 LRGFFGSEPKILFSYKCQVDEAEEPDMHLPQPYAVARREGIE 318
>LYTS_STRMU (Q8DVB6) Sensor protein lytS (EC 2.7.13.3)| Length = 580 Score = 30.8 bits (68), Expect = 3.6 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 5/56 (8%) Frame = -1 Query: 582 LAATANGNGIGNSLASAMGQQTVTEKKFGGIA-----PKKPLISKDHERAYFDSAD 430 +A + NG GI ++ +GQ+TV+E K G A + L+ + +FDS D Sbjct: 503 VAVSDNGQGISPNMIDKLGQETVSESKGTGTALVNLNNRLNLLYGSASQLHFDSTD 558
>GP175_HUMAN (Q86W33) Integral membrane protein GPR175| Length = 373 Score = 30.8 bits (68), Expect = 3.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 470 IRGFFGAIPPNFFSVTVCCPMAEASELPMPLPFAVAASHPVDLSSA 607 +RGFFG+ P FS E ++ +P P+AVA ++ + A Sbjct: 280 LRGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGA 325
>CF150_HUMAN (Q8N884) Protein C6orf150| Length = 522 Score = 30.4 bits (67), Expect = 4.8 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = -3 Query: 421 RQASCKQQRAGCSNRVLEAKAKEDAPSPAPPSQAGLRVRLIDRDA 287 R SC+Q+ A CS + D PSP P A + VR RDA Sbjct: 117 RAGSCRQRGARCSTKPRPPPGPWDVPSPGLPVSAPILVR---RDA 158
>FTSB_XYLFT (Q87DY5) Cell division protein ftsB homolog| Length = 118 Score = 30.4 bits (67), Expect = 4.8 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 545 ELPMPLPFAVAASHPVDLSSAKRRKK 622 ++P+PLP +A H VDLS +R K+ Sbjct: 93 DIPVPLPNDTSADHGVDLSQPRREKR 118 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,324,756 Number of Sequences: 219361 Number of extensions: 1264178 Number of successful extensions: 3662 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3651 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)