| Clone Name | rbaal34o17 |
|---|---|
| Clone Library Name | barley_pub |
>ORYA_ORYSA (P25776) Oryzain alpha chain precursor (EC 3.4.22.-)| Length = 458 Score = 48.1 bits (113), Expect = 6e-06 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSYXXXXXXXXXXXXXXXXXXXXXXSVCDSYNECP 2 MERNIKASSGKCGIAVEPSY +VCD+Y CP Sbjct: 323 MERNIKASSGKCGIAVEPSYPLKKGENPPNPGPTPPSPTPPPTVCDNYYTCP 374
>RD21A_ARATH (P43297) Cysteine proteinase RD21a precursor (EC 3.4.22.-) (RD21)| Length = 462 Score = 40.8 bits (94), Expect = 0.001 Identities = 22/52 (42%), Positives = 25/52 (48%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSYXXXXXXXXXXXXXXXXXXXXXXSVCDSYNECP 2 M RNI +SSGKCGIA+EPSY + CDSY CP Sbjct: 331 MARNIASSSGKCGIAIEPSYPIKNGENPPNPGPSPPSPIKPPTQCDSYYTCP 382
>CPGP1_ZINOF (P82473) Cysteine proteinase GP-I (EC 3.4.22.-)| Length = 221 Score = 36.2 bits (82), Expect = 0.025 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSY 98 +ERNI SSGKCGIA+ PSY Sbjct: 195 VERNIAESSGKCGIAISPSY 214
>CYSP4_BRANA (P25251) Cysteine proteinase COT44 precursor (EC 3.4.22.-)| (Fragment) Length = 328 Score = 35.4 bits (80), Expect = 0.043 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSY 98 MERN+ + SGKCGIA+E SY Sbjct: 294 MERNVASKSGKCGIAIEASY 313
>CYSPL_LYCES (P20721) Low-temperature-induced cysteine proteinase precursor (EC| 3.4.22.-) (Fragment) Length = 346 Score = 35.4 bits (80), Expect = 0.043 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSYXXXXXXXXXXXXXXXXXXXXXXSVCDSYNEC 5 ++RN+ +SSG CG+A+EPSY + CD Y++C Sbjct: 212 VQRNVSSSSGLCGLAIEPSYPVKTGPNPPKPAPSPPSPVKPPTECDEYSQC 262
>GCP1_ARATH (Q94B08) Germination-specific cysteine protease 1 precursor (EC| 3.4.22.-) Length = 376 Score = 33.5 bits (75), Expect = 0.16 Identities = 17/21 (80%), Positives = 18/21 (85%), Gaps = 1/21 (4%) Frame = -3 Query: 157 MERNIKAS-SGKCGIAVEPSY 98 MERN+ AS SGKCGIAVE SY Sbjct: 339 MERNLAASKSGKCGIAVEASY 359
>CYSP1_ORYSA (Q7XR52) Cysteine protease 1 precursor (EC 3.4.22.-) (OsCP1)| Length = 490 Score = 31.6 bits (70), Expect = 0.62 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSY 98 MERN+ A +GKCGIA+ SY Sbjct: 353 MERNVTARTGKCGIAMMASY 372
>ORYB_ORYSA (P25777) Oryzain beta chain precursor (EC 3.4.22.-)| Length = 471 Score = 31.6 bits (70), Expect = 0.62 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSY 98 MERNI ++GKCGIA+ SY Sbjct: 335 MERNINVTTGKCGIAMMASY 354
>ERVB_TABDI (P60994) Ervatamin-B (EC 3.4.22.-) (ERV-B)| Length = 215 Score = 31.2 bits (69), Expect = 0.81 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSY 98 MERN+ +S+G CGIA PSY Sbjct: 192 MERNVASSAGLCGIAQLPSY 211
>BROM2_ANACO (P14518) Bromelain, stem (EC 3.4.22.32)| Length = 212 Score = 29.6 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSY 98 M R++ +SSG CGIA++P Y Sbjct: 188 MARDVSSSSGICGIAIDPLY 207
>CYSEP_PHAVU (P25803) Vignain precursor (EC 3.4.22.-) (Bean endopeptidase)| (Cysteine proteinase EP-C1) Length = 362 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSY 98 M+RNI G CGIA+ PSY Sbjct: 323 MQRNISKKEGLCGIAMLPSY 342
>CPR1_ARATH (Q9LT77) Probable cysteine proteinase At3g19400 precursor (EC| 3.4.22.-) Length = 362 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSY 98 ++RNI GKCGIA+ PSY Sbjct: 327 LQRNIDDPFGKCGIAMMPSY 346
>CYSP_HEMSP (P43156) Thiol protease SEN102 precursor (EC 3.4.22.-)| Length = 360 Score = 28.9 bits (63), Expect = 4.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSY 98 M+R I GKCGIA+E SY Sbjct: 324 MQRGISDKRGKCGIAMEASY 343
>NOEL_RHIFR (O85713) GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (GDP-D-mannose| dehydratase) Length = 351 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -3 Query: 154 ERNIKASSGKCGIAVEPSY 98 ER I A++GKC +AV+P Y Sbjct: 285 ERGIDAATGKCVVAVDPRY 303
>CYSEP_RICCO (O65039) Vignain precursor (EC 3.4.22.-) (Cysteine endopeptidase)| Length = 360 Score = 27.7 bits (60), Expect = 9.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 157 MERNIKASSGKCGIAVEPSY 98 MER I G CGIA+E SY Sbjct: 321 MERGISDKEGLCGIAMEASY 340 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,623,716 Number of Sequences: 219361 Number of extensions: 99730 Number of successful extensions: 178 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 178 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)