| Clone Name | rbaal34o10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MURG_CHLTR (O84766) UDP-N-acetylglucosamine--N-acetylmuramyl-(pe... | 32 | 1.7 | 2 | MURG_CHLTA (Q3KKT1) UDP-N-acetylglucosamine--N-acetylmuramyl-(pe... | 32 | 1.7 | 3 | PGCA_CANFA (Q28343) Aggrecan core protein precursor (Cartilage-s... | 30 | 3.9 |
|---|
>MURG_CHLTR (O84766) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 352 Score = 31.6 bits (70), Expect = 1.7 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 48 ISVPPILGPRPNIRNHHHRTSLFYIHTVGTGT 143 + VP IL P P H + F+ HTVG GT Sbjct: 269 VQVPAILIPYPGAYGHQEVNAKFFTHTVGGGT 300
>MURG_CHLTA (Q3KKT1) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 352 Score = 31.6 bits (70), Expect = 1.7 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 48 ISVPPILGPRPNIRNHHHRTSLFYIHTVGTGT 143 + VP IL P P H + F+ HTVG GT Sbjct: 269 VQVPAILIPYPGAYGHQEVNAKFFTHTVGGGT 300
>PGCA_CANFA (Q28343) Aggrecan core protein precursor (Cartilage-specific| proteoglycan core protein) (CSPCP) Length = 2333 Score = 30.4 bits (67), Expect = 3.9 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = +3 Query: 342 SPAISVTGRTSAHELLSALPTLITTTWSSAGTFHASFPSLASVATT 479 S A V+G +S E+ S+LP+ T+ +G FH +FP++ V T Sbjct: 1698 SGAAEVSGESSGAEVGSSLPS---GTYEGSGNFHPAFPTVFLVDRT 1740 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,568,849 Number of Sequences: 219361 Number of extensions: 1341732 Number of successful extensions: 3605 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3605 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)