| Clone Name | rbaal34o05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | THIO_RAT (P11232) Thioredoxin | 31 | 4.6 | 2 | THIO_MOUSE (P10639) Thioredoxin (ATL-derived factor) (ADF) | 31 | 4.6 | 3 | 1433_TRIHA (Q99002) 14-3-3 protein homolog (Th1433) | 31 | 4.6 | 4 | COLI_LEPOS (Q91082) Corticotropin-lipotropin precursor (Pro-opio... | 30 | 6.1 | 5 | AA2DB_BRARE (Q8JG69) Alpha-2Db adrenergic receptor (Alpha-2Db ad... | 30 | 7.9 | 6 | PRP1_BOMMO (Q27451) Phenoloxidase subunit 1 precursor (EC 1.14.1... | 30 | 7.9 |
|---|
>THIO_RAT (P11232) Thioredoxin| Length = 104 Score = 30.8 bits (68), Expect = 4.6 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 666 SLCEKYPHIVHEEYSEEIDHEKCQDLVPDCD 574 SLC+KY ++V E +D + CQD+ DC+ Sbjct: 43 SLCDKYSNVVFLE----VDVDDCQDVAADCE 69
>THIO_MOUSE (P10639) Thioredoxin (ATL-derived factor) (ADF)| Length = 104 Score = 30.8 bits (68), Expect = 4.6 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 666 SLCEKYPHIVHEEYSEEIDHEKCQDLVPDCD 574 SLC+KY ++V E +D + CQD+ DC+ Sbjct: 43 SLCDKYSNVVFLE----VDVDDCQDVAADCE 69
>1433_TRIHA (Q99002) 14-3-3 protein homolog (Th1433)| Length = 262 Score = 30.8 bits (68), Expect = 4.6 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 3/87 (3%) Frame = -3 Query: 729 DIVGWRTSSIRRNTELPKWEESLCEKYPHIVHEEYSEEIDHEK---CQDLVPDCDFDLLE 559 +++G R +S R T + + EES + +EY ++I++E C D++ D L+ Sbjct: 50 NVIGARRASWRIVTSIEQKEESKGNSSQVTLIKEYRQKIENELAKICDDILEVLDQHLIP 109 Query: 558 EKMVTGLRRVSWEKVDVSFHASMRSFA 478 +G +V + K+ +H + FA Sbjct: 110 SAK-SGESKVFYHKIKGDYHRYLAEFA 135
>COLI_LEPOS (Q91082) Corticotropin-lipotropin precursor (Pro-opiomelanocortin)| (POMC) [Contains: NPP; Gamma-melanotropin-like segment; Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediary pept Length = 259 Score = 30.4 bits (67), Expect = 6.1 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -3 Query: 651 YPHIVHEEYSEEIDHEKCQDLVPDCDFDLLEE 556 YP+ V EE +E E +DL+ D D+ LLEE Sbjct: 157 YPNGVEEESAEAYPTEMRRDLMSDLDYPLLEE 188
>AA2DB_BRARE (Q8JG69) Alpha-2Db adrenergic receptor (Alpha-2Db adrenoceptor)| (Alpha-2Db adrenoreceptor) (Alpha(2Db)AR) Length = 415 Score = 30.0 bits (66), Expect = 7.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 415 VMNFHHNARFAEGRHLDNAVRCETPHARV 501 V N H N+RFA+ R ++ A C P+ R+ Sbjct: 274 VSNRHRNSRFAKSRKVEGAQSCPKPNGRL 302
>PRP1_BOMMO (Q27451) Phenoloxidase subunit 1 precursor (EC 1.14.18.1)| (Tyrosinase 1) (PO 1) Length = 685 Score = 30.0 bits (66), Expect = 7.9 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +3 Query: 561 PVSQNRSLVPNLDTSRDRFLQSIPHV 638 PV Q RS V L+T RDRFLQ+I ++ Sbjct: 300 PVDQIRSDVSELETWRDRFLQAIENM 325 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 109,031,757 Number of Sequences: 219361 Number of extensions: 2278603 Number of successful extensions: 5594 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5592 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7819576386 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)