| Clone Name | rbaal34k02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RPOC2_SOYBN (Q8HVY3) DNA-directed RNA polymerase beta'' chain (E... | 28 | 6.6 |
|---|
>RPOC2_SOYBN (Q8HVY3) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1386 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 6/33 (18%) Frame = -3 Query: 96 HNNVC------ISFGNFGCEQISFVKSKGAPRL 16 H+N C +S G F CE + V++K AP L Sbjct: 1056 HHNYCEKTFTIMSLGQFICENVCIVQTKNAPHL 1088 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,263,647 Number of Sequences: 219361 Number of extensions: 575979 Number of successful extensions: 1254 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1254 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)