| Clone Name | rbaal34j07 |
|---|---|
| Clone Library Name | barley_pub |
>YCZ2_SCHPO (O74556) Putative mannan endo-1,6-alpha-mannosidase C970.02| precursor (EC 3.2.1.101) (Endo-alpha-1->6-D-mannanase C970.02) Length = 442 Score = 30.4 bits (67), Expect = 1.2 Identities = 18/70 (25%), Positives = 33/70 (47%) Frame = +2 Query: 38 GIFIDVIYWWEITNQVGNVLADRYLCRGKDMKIYRLSVWCSPSIVELISSFIKSGT*DDD 217 G+F+ YWWE N L +RY+ G + + EL+ + + + +D Sbjct: 55 GMFLPPAYWWE-AGAAWNGLLNRYIATG------------NSTYNELVKTSMLYQSGEDS 101 Query: 218 DVLPSNVSST 247 D +PSN +++ Sbjct: 102 DYMPSNYTTS 111
>GNA1_CAEEL (Q17427) Glucosamine 6-phosphate N-acetyltransferase (EC 2.3.1.4)| (Phosphoglucosamine transacetylase) (Phosphoglucosamine acetylase) Length = 165 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 50 DVIYWWEITNQ-VGNVLADRYLCRGKDMKIYRLSVWCSPSIVELISSF 190 DV+ E+ Q +G VL + GK + +Y++S+ C P ++ S F Sbjct: 105 DVVVDTEMRRQKLGAVLLKTLVSLGKSLGVYKISLECVPELLPFYSQF 152
>EST2_HUMAN (O00748) Carboxylesterase 2 precursor (EC 3.1.1.1) (CE-2) (hCE-2)| Length = 559 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 55 YILVGNHQPSWKRTGRSLFMQGERHEDLPFV 147 Y HQPSW + R M+ + ++LPFV Sbjct: 434 YFYEFQHQPSWLKNIRPPHMKADHGDELPFV 464
>HEXB_RAT (Q6AXR4) Beta-hexosaminidase beta chain precursor (EC 3.2.1.52)| (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) (Hexosaminidase B) Length = 537 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +3 Query: 141 VCPFGVLPALWSSFPLS*KVEPRMMMMS 224 V PFG+ PALW P S +V PR++ +S Sbjct: 25 VAPFGLQPALW-PMPRSVQVFPRLLYIS 51
>UHRF2_MOUSE (Q7TMI3) Ubiquitin-like PHD and RING finger domain-containing| protein 2 (EC 6.3.2.-) (Ubiquitin-like-containing PHD and RING finger domains protein 2) (Np95-like ring finger protein) (Nuclear zinc finger protein Np97) (NIRF) Length = 803 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 14 PVTSTSHDGIFIDVIYWWEITNQVGNVLADRYLCRGKDMK 133 P +DGI+ V YW EI++ G L RYL R D++ Sbjct: 579 PEEGNRYDGIYKVVKYWPEISSSHG-FLVWRYLLRRDDVE 617
>UHRF2_HUMAN (Q96PU4) Ubiquitin-like PHD and RING finger domain-containing| protein 2 (EC 6.3.2.-) (Ubiquitin-like-containing PHD and RING finger domains protein 2) (Np95/ICBP90-like RING finger protein) (Np95-like RING finger protein) (Nuclear zinc finger Length = 802 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 14 PVTSTSHDGIFIDVIYWWEITNQVGNVLADRYLCRGKDMK 133 P +DGI+ V YW EI++ G L RYL R D++ Sbjct: 578 PEEGNRYDGIYKVVKYWPEISSSHG-FLVWRYLLRRDDVE 616
>ASB15_BOVIN (Q8HXA6) Ankyrin repeat and SOCS box protein 15 (ASB-15)| Length = 588 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 Query: 62 WWEITNQVGNVLADRYLCRGKDMKIYRLSVWCSPSIVELIS 184 W EI + N + ++LCR K ++ L C P+++E +S Sbjct: 524 WPEIRQILENPCSLKHLCRLKIRRLMGLQRLCQPTLMEKLS 564 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,553,542 Number of Sequences: 219361 Number of extensions: 994470 Number of successful extensions: 2254 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2254 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)